DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chi and SLK3

Sequence 1:NP_726403.2 Gene:Chi FlyBaseID:FBgn0013764 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_680741.5 Gene:SLK3 AraportID:AT4G25515 Length:685 Species:Arabidopsis thaliana

Alignment Length:551 Identity:97/552 (18%)
Similarity:173/552 (31%) Gaps:189/552 (34%)


  Fly   207 GNHPMMGGPQQMERIDQGFRRHNSYFSHTE-------HRVFELNKRLQQRNEE------------ 252
            |.:|.|....|.:|:    |:|........       .:..:|.::|||:..:            
plant    99 GRNPQMQALLQQQRV----RQHQQMLQSMSPSQRLQLQKQQQLRQQLQQQGTQQISPNVRPYEVG 159

  Fly   253 -----------------SDNC--WWDSFTTEFFEDDARLTILFCLEDGPKRYTIGR--------- 289
                             ::||  :|..|..|:|...|:..:.....:....:.:|.         
plant   160 VCARKLMMYLYHLQQRPAENCITYWRKFVAEYFSPRAKQRLCLSQYESVGHHALGMFPQAAPDMW 224

  Fly   290 -----------------TLIPRFFRSIYEGGVSDLYFQLKHAKES-FHNTSITLDCDQCTVITQH 336
                             .::.|.....:..|:.|....|.|.:|: |.|..:.|:..:....|.|
plant   225 QCDLCGTKSGKGFEATFDVLARLIEIKFASGIIDELLYLDHPRENRFPNGLMMLEYRKAVQETVH 289

  Fly   337 GKPFFTKVCADARLILEFMYDDYMRIKSWHMTIKGHRELIPRSVIGTSLPPDPMLLDQITKNITR 401
            .:   .:|..:..|.:.|..|  ::|.||....:.|.||:.|.:|...:.....:..:....|:.
plant   290 EQ---FRVVREGHLRIIFSPD--LKILSWEFCARRHEELLLRRLIAPQVNQLLQVAQKCQSTISE 349

  Fly   402 AGI---------TNST--------------------LNY-------LRLCVILEPMQELMSRHKA 430
            :|.         :||.                    |.|       |::..:::.|::||:....
plant   350 SGSQGVSQQDIQSNSNMVLGAGRQLAKFMELQSLNDLGYPKRYIRTLQISEVVKSMKDLMNFTGE 414

  Fly   431 YALSPRDCLKTTLFQ----KWQRM----VAPPGKKDPQRPPNKRRKRKGSNSGGG----NNSN-- 481
            :.:.|.:.||..|.|    |.||.    :...|.......|.:.:....|.:..|    ||||  
plant   415 HKVGPLEGLKQLLEQTATVKLQRQKMQEMEQFGNSGAMSGPAQAQMTLSSGTMSGSTANNNSNNH 479

  Fly   482 -----------TPPVT----------------NQKRSPSGPSFSLSSQDVMVVGEPTLMGGE--- 516
                       :|..|                |.:.|.:|.....|||:      |||...:   
plant   480 HQIVGRGAMNGSPQATAALTNYQSMLIRQNAMNNQNSNTGNQEGFSSQN------PTLNSNQSPS 538

  Fly   517 -FGEEDERLIT-------RLENTQY--DGTNAVEHDNHTGFGHADSPISGSNPW----------- 560
             ..::.|.|.|       :::..|:  :||..:...||.  ....||.|..|..           
plant   539 SSSQQRENLATSGFPSSPQMQQQQHILNGTPNMLPQNHP--HQLQSPHSHGNTQEQQMLHQLLQE 601

  Fly   561 ------SIDRAGAIPASPGNGAAPQNNANIS 585
                  |:::..|.|...|:....:.|...|
plant   602 MTENGASVEQQQAFPGQSGSNNNTERNTTAS 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChiNP_726403.2 LIM_bind 238..440 CDD:280051 47/296 (16%)
SLK3NP_680741.5 LIM_bind 164..424 CDD:280051 43/265 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10378
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.