DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chi and ldb-1

Sequence 1:NP_726403.2 Gene:Chi FlyBaseID:FBgn0013764 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_509844.3 Gene:ldb-1 WormBaseID:WBGene00002261 Length:629 Species:Caenorhabditis elegans

Alignment Length:485 Identity:136/486 (28%)
Similarity:213/486 (44%) Gaps:113/486 (23%)


  Fly   164 FSRPASSGTPFNSGQAGHFSSPTVFSVGGQFNPMPPASPFGHGGNHPMMGGPQQMERIDQGFRRH 228
            |.||.|:..|.|     |..         |...: .|:..|..|.......||.:          
 Worm    53 FHRPPSARPPLN-----HVD---------QLKSL-QATALGKPGMRSQATEPQPI---------- 92

  Fly   229 NSYFSHTEHRVFELNKRLQ-------QRNEESDNCWWDSFTTEFFEDDARLTILFCLEDGP---- 282
            .:..|..|.|:.::|:||.       ..|::..  |||:|:.|||:||.:|  .|.:...|    
 Worm    93 GNTVSPLEFRIHDMNRRLYIFSSTGVSENDQQQ--WWDAFSHEFFDDDCKL--WFVIGSEPVAFA 153

  Fly   283 --KRYTIGRTLIPRFFRSIYEGGVSDLYFQLKHAKE--SFHNTSITLDCDQCTVITQHGKPFFTK 343
              :||.|.|..||:|||||::.|:.:|.:.|:....  :..|.|...:.:....||::.:....:
 Worm   154 SRERYIINRQFIPKFFRSIFDSGMRELQYVLRGPSRECTLANGSQAYENENVLQITRYDQSSQFE 218

  Fly   344 VCADARLILEFM-YDDYM--RIKSWHMTIKGHRELIPRSVIGTSLPPDPMLLDQIT--------- 396
            |..:.:|.:||. :|:.|  |||:|.:.:|...|.:               .:|.|         
 Worm   219 VNTEGKLYVEFAPFDEVMNYRIKAWTLELKRSNEFV---------------YNQNTADYRVEAQN 268

  Fly   397 ---KNITRAGITNSTLNYLRLCVILEPMQELMSRHK-AYALSPRDCLKTTLFQKW---------- 447
               :|..|.|...||.|.:.:..||:|||.:||..| |.|::||:.:|.||||..          
 Worm   269 PEQENKPRMGFFKSTFNLMTMLKILDPMQSIMSSAKSAPAITPREVMKRTLFQHHQVRQQNMRQQ 333

  Fly   448 ---QRMVAPPGKKDPQRPPNKRRKRKGSNSGGGN-------------NSNTPPV------TNQKR 490
               |:|:.|..:.:..:|..||:::..:|..|..             .:..||.      .|.::
 Worm   334 QLNQQMMIPAPEPEKPKPARKRQRKPAANPRGSKKATAAAAAAAAAATNGVPPTVPTASPANNQQ 398

  Fly   491 SPSGPSFS----LSSQDVMVVGEPTLMGGEFGEEDERLITRLENTQYDGTNAVEHDNHTGFGHAD 551
            .|..|..|    :|..||||||||::||.||||.|||.|:|:||:||| .||::..:.....::.
 Worm   399 FPPNPMTSQFQQMSYPDVMVVGEPSMMGSEFGENDERTISRVENSQYD-PNAMQMQSLGQGPNSS 462

  Fly   552 SPISGSNPWSIDRAGAIPASPGNGAAPQNN 581
            ..|:|.|..:....|..| .||....|.::
 Worm   463 MNINGRNMMNQHHPGMQP-PPGQQHMPPHS 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChiNP_726403.2 LIM_bind 238..440 CDD:280051 67/233 (29%)
ldb-1NP_509844.3 LIM_bind 102..316 CDD:280051 67/233 (29%)
CITED 447..>538 CDD:282356 10/47 (21%)
Forkhead_N 494..612 CDD:254796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21723413
eggNOG 1 0.900 E1_KOG2181
Hieranoid 1 1.000
Homologene 1 1.000 H989
Inparanoid 1 1.050 155 1.000 Inparanoid score I2891
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001635
OrthoInspector 1 1.000 T474576
orthoMCL 1 0.900 OOG5_130782
Panther 1 1.100 LDO PTHR10378
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3240
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.