DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chi and ldb2

Sequence 1:NP_726403.2 Gene:Chi FlyBaseID:FBgn0013764 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_002938682.1 Gene:ldb2 XenbaseID:XB-GENE-490279 Length:397 Species:Xenopus tropicalis

Alignment Length:423 Identity:239/424 (56%)
Similarity:285/424 (67%) Gaps:70/424 (17%)


  Fly   196 PMPP--ASPFGHGGNHPMMGGPQQMERIDQGFRRHNSYFSHTEHRVFELNKRLQQRNEESDNCWW 258
            |..|  :||||     |.             :|||:.|....|:|::|:|||||.|.|:|||.||
 Frog     5 PHDPFYSSPFG-----PF-------------YRRHSPYMVQPEYRIYEMNKRLQTRTEDSDNLWW 51

  Fly   259 DSFTTEFFEDDARLTILFCLEDGPKRYTIGRTLIPRFFRSIYEGGVSDLYFQLKHAKESFHNTSI 323
            |:|.||||||||.||:.|||||||||||||||||||:|.:::||||:|||:.|||:|||:||:||
 Frog    52 DAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSI 116

  Fly   324 TLDCDQCTVITQHGKPFFTKVCADARLILEFMYDDYMRIKSWHMTIKGHRELIPRSVIGTSLPPD 388
            |:||||||::||||||.|||||.:.||||||.:||.||||:||.||:.:|||:|||::... ..|
 Frog   117 TVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMH-AQD 180

  Fly   389 PMLLDQITKNITRAGITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLFQKWQRMVAP 453
            |.:|:|::|||||.|:||.||||||||||||||||||||||.|.|||||||||.|||||||||||
 Frog   181 PQVLEQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAP 245

  Fly   454 PGKKDPQR-PPNKRRKRKGSNSGGGNNS---NTPPVTNQKRSPSGPSFSLSSQ------------ 502
            |.  :|.| ...||||||.|.|...|||   ||....|:|:.|:| |.:||:|            
 Frog   246 PA--EPTRQTTTKRRKRKNSTSNTSNNSTGNNTISTYNKKKLPAG-SHNLSNQAPFTTKKCIGDK 307

  Fly   503 --------------DVMVVGEPTLMGGEFGEEDERLITRLENTQYDGTNAVEHDNHTGFGHADSP 553
                          ||||||||||||||||:|||||||||||||||..|.:  |:...|.  :||
 Frog   308 TRVRRNYRGIRNGLDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGM--DDEEDFN--NSP 368

  Fly   554 ISGSNPWSIDRAGAIPASPGNGAAPQNNANISD 586
            ..|:|            ||.|...|.|....||
 Frog   369 ALGNN------------SPWNSKPPPNAETKSD 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChiNP_726403.2 LIM_bind 238..440 CDD:280051 145/202 (72%)
ldb2XP_002938682.1 LIM_bind 31..232 CDD:280051 145/202 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21725557
eggNOG 1 0.900 E1_KOG2181
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H989
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001635
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.700

Return to query results.
Submit another query.