DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3121 and Rsph6a

Sequence 1:NP_611869.1 Gene:CG3121 FlyBaseID:FBgn0034957 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_112545.2 Gene:Rsph6a MGIID:1927643 Length:708 Species:Mus musculus

Alignment Length:661 Identity:205/662 (31%)
Similarity:304/662 (46%) Gaps:167/662 (25%)


  Fly    74 NPEAPNIGYELNVAKSILQKYSTLSGDNLFDHLSDIIKRVIDERPPNVIDFFEEFSRNVREQKFH 138
            :||...:.  :..||:.|.:.|.....:|::||.:::.:::::||.:.:...|..:|.::.:.||
Mouse   184 DPEPRELA--IQNAKAYLLRTSMSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFH 246

  Fly   139 L--------PERFPPSGVFDEVRSFRVAKKILQSMKLPYV---VEGEDLMGEDLSVEDLRTNEDM 192
            .        ||..|         ::.:|:|    .|..::   .|||..|.|:            
Mouse   247 PKLDTLRDDPEMQP---------TYEMAEK----QKALFIRGGGEGEQEMEEE------------ 286

  Fly   193 RIVIDDSMRYFVTFNERVQQLQFYWTQCGFSISNDDIFQLASAMNRLQTHPSIMQCRFWGCINGL 257
              |.|..:       ..:.:..||:.|.|..:|:|:.|::..|:.:|.....|..|||||.|.||
Mouse   287 --VTDSPV-------PNIMETAFYFEQAGVGLSSDESFRIFLALKQLVEQQPIHMCRFWGKILGL 342

  Fly   258 KASYYIVEASLTREEIASRLVMMEEEMRQKQIPFPMRKDREDKPPPAHIGPEL--TPGIYGWEEF 320
            ..||.:.|... ||.        |||..::::...|.            |.|:  |.|    ||.
Mouse   343 SRSYLVAEVEF-REG--------EEEGEEEEVEEMME------------GGEVLETHG----EEE 382

  Fly   321 PPEELEKM-----KPKAAPVPLVEEMELYDIPPEFIGKGCNRYSYFVVNSLFDDWIELPIVTPRQ 380
            ..|:.||:     ||:..|.|:        ||.|....|.|:|.|||.|.....|..||.|||.|
Mouse   383 GEEDEEKVVDSVPKPQWKPPPI--------IPKEESRSGTNKYLYFVCNEPGRPWTRLPHVTPAQ 439

  Fly   381 IVVSRQIKKFLTGDLEADVISYPCFPGKEKHYLRTLIGRITAGTYIAPVGYYRRMTKKEQRMFDG 445
            ||.:|:||||.||.|:..|||||.|||.|.:|||..|.||:|.|:|:|:|:|             
Mouse   440 IVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAATHISPLGFY------------- 491

  Fly   446 EEEEEGEEEEEEEEE-----EEFNEGEEEQIEDNDVMLLKNEKYEAEPLGSLATPVA-WVHVRSN 504
               :.||||.:||||     :.|.|               |..:|..|:..|...:| |||...:
Mouse   492 ---QFGEEEGDEEEEGGAGRDSFEE---------------NPDFEGIPVLELVDSMANWVHHTQH 538

  Fly   505 ILNQQGRVVWYDEEKARKEREKALALYLKMQMLGEMEEEVEEEEDEEEGEEEGEEEGMIEGFNQP 569
            || .|||..|.:                .:|...|.||..||||..:|..||.|:          
Mouse   539 IL-PQGRCTWVN----------------PLQKTEEEEELGEEEEKADEAMEEVEQ---------- 576

  Fly   570 ELGPSILSSCAND-----MNPEVPVSWLARMTSKYTNQKERMLVMQSNVWPGAYTFIFEKTCESI 629
            |:||.:|:..:.|     ::|     |..|::...:.|.. :.:::||:|||||.:...|..|:|
Mouse   577 EVGPPLLTPLSEDAEIMHLSP-----WTTRLSCSLSPQYS-VAIVRSNLWPGAYAYATGKKFENI 635

  Fly   630 YLGWGHKYYARNI-PFKHLP-MVQEEFPHNPEDFVEANDPTVEEEEAYKAWLLRKQQKAEYVAED 692
            |:||||||...|. |.  || ::|:|:|..|| ..|.:|||||||:|.||...:....||...||
Mouse   636 YIGWGHKYSPENFNPM--LPALIQQEYPSGPE-ITEMSDPTVEEEQALKAAQEQALAAAEEEEED 697

  Fly   693 IEDYDDDEFAD 703
            .|:.:|::..|
Mouse   698 EEEEEDEDLED 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3121NP_611869.1 Radial_spoke 83..679 CDD:282555 196/627 (31%)
Rsph6aNP_112545.2 Radial_spoke 191..681 CDD:282555 194/626 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C356377572
eggNOG 1 0.900 E1_28KDA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I2991
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003149
OrthoInspector 1 1.000 T617089
orthoMCL 1 0.900 OOG5_129136
Panther 1 1.100 O PTHR13159
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6491
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.