DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3121 and RSPH6A

Sequence 1:NP_611869.1 Gene:CG3121 FlyBaseID:FBgn0034957 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_110412.1 Gene:RSPH6A HGNCID:14241 Length:717 Species:Homo sapiens

Alignment Length:655 Identity:196/656 (30%)
Similarity:301/656 (46%) Gaps:139/656 (21%)


  Fly    70 HNARNPEAPNIGYELNVAKSILQKYSTLSGDNLFDHLSDIIKRVIDERPPNVIDFFEEFSRNVRE 134
            ::|:.||...:...:..||:.|.:.|.....:|::||.:::.:::::||.:.:...|..:|..:.
Human   185 YSAQVPEPEPLELAVQNAKAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQW 249

  Fly   135 QKFHLPERFPPSGVFDEVRSFRVAKKILQSMKLPYV-----VEGEDLMGEDLSVEDLRTNEDMRI 194
            :.||     |......:....:...|:.:..|..:.     .|||..|.|::....:        
Human   250 EWFH-----PKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPV-------- 301

  Fly   195 VIDDSMRYFVTFNERVQQLQFYWTQCGFSISNDDIFQLASAMNRLQTHPSIMQCRFWGCINGLKA 259
                         ..:.:..||:.|.|..:|:|:.|::..||.:|.....|..|||||.|.|:|.
Human   302 -------------PNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKR 353

  Fly   260 SYYIVEASLTREEIASRLVMMEEEMRQKQIPFPMRKDREDKPPPAHIGPELTPG-----IYGWEE 319
            ||.:.|... ||.        |||..::::                  .|:|.|     .:|.||
Human   354 SYLVAEVEF-REG--------EEEAEEEEV------------------EEMTEGGEVMEAHGEEE 391

  Fly   320 FPPEELEK---MKPKAA--PVPLVEEMELYDIPPEFIGKGCNRYSYFVVNSLFDDWIELPIVTPR 379
            ...:| ||   :.||:.  |.|:        ||.|....|.|:|.|||.|.....|..||.|||.
Human   392 GEEDE-EKAVDIVPKSVWKPPPV--------IPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPA 447

  Fly   380 QIVVSRQIKKFLTGDLEADVISYPCFPGKEKHYLRTLIGRITAGTYIAPVGYYRRMTKKEQRMFD 444
            |||.:|:||||.||.|:..|:|||.|||.|.:|||..|.||:|.|.::|:|:|:           
Human   448 QIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQ----------- 501

  Fly   445 GEEEEEGEEEEEEEEEEEFNEGEEEQIEDNDVMLLKNEKYEAEPLGSLATPVA-WVHVRSNILNQ 508
                   ..|||.:||||...|.:...|:.|        :|..|:..|...:| |||...:|| .
Human   502 -------FSEEEGDEEEEGGAGRDSYEENPD--------FEGIPVLELVDSMANWVHHTQHIL-P 550

  Fly   509 QGRVVWYDEEKARKEREKALALYLKMQMLGEMEEEVEEEEDEEEGEEEGEEEGMIEGFNQPELGP 573
            |||..|.:                .:|...|.|:..||||..:||.||.|:          |:||
Human   551 QGRCTWVN----------------PLQKTEEEEDLGEEEEKADEGPEEVEQ----------EVGP 589

  Fly   574 SILSSCANDMNPEVPVSWLARMTSKYTNQKERMLVMQSNVWPGAYTFIFEKTCESIYLGWGHKYY 638
            .:|:..:.|........|..|::.....|.. :.|::||:|||||.:...|..|:||:||||||.
Human   590 PLLTPLSEDAEIMHLAPWTTRLSCSLCPQYS-VAVVRSNLWPGAYAYASGKKFENIYIGWGHKYS 653

  Fly   639 ARNI-PFKHLPMVQEEFPHNPEDFVEANDPTVEEEEAYKAWLLRKQQKAEYVAEDIEDYDDDEFA 702
            ..:. |....| :|:|:|..|| .:|.:|||||||:|.||    .|::|....|:.|:.:::|..
Human   654 PESFNPALPAP-IQQEYPSGPE-IMEMSDPTVEEEQALKA----AQEQALGATEEEEEGEEEEEG 712

  Fly   703 DQYDD 707
            ::.||
Human   713 EETDD 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3121NP_611869.1 Radial_spoke 83..679 CDD:282555 186/613 (30%)
RSPH6ANP_110412.1 Radial_spoke 198..693 CDD:282555 186/617 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C356383118
eggNOG 1 0.900 E1_28KDA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I2957
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D166599at33208
OrthoFinder 1 1.000 FOG0003149
OrthoInspector 1 1.000 T610287
orthoMCL 1 0.900 OOG5_129136
Panther 1 1.100 O PTHR13159
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6491
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.