DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3121 and Rsph4a

Sequence 1:NP_611869.1 Gene:CG3121 FlyBaseID:FBgn0034957 Length:708 Species:Drosophila melanogaster
Sequence 2:XP_003752009.1 Gene:Rsph4a RGDID:1307229 Length:711 Species:Rattus norvegicus

Alignment Length:659 Identity:204/660 (31%)
Similarity:318/660 (48%) Gaps:150/660 (23%)


  Fly    64 DSQCNLHNARNPEAPNIG--------YELNV--AKSILQKYSTLSGDNLFDHLSDIIKRVIDERP 118
            ||..|.    :|:.|.:|        .|:.|  ||:.|...|:.||.||:||||.::.:::||||
  Rat   184 DSNSNC----DPDQPEVGASEAAPSMLEVAVQNAKAYLLSTSSKSGLNLYDHLSKVLTKILDERP 244

  Fly   119 PNVIDFFEEFSRNVREQKF-------HLPERFPPSGVFDEVRSFRVAKKILQSMKLPYVVEGEDL 176
            .:.:|..|..|::|:...|       |......|            |.::.::.|..: ::|. |
  Rat   245 VDAVDVVENISQDVKMSHFDKKLDTLHNENEMLP------------AYELAETQKALF-LQGH-L 295

  Fly   177 MGEDLSVEDLRTNEDMRIVIDDSMRYFVTFNERVQQLQFYWTQCGFSISNDDIFQLASAMNRL-Q 240
            .|.|..:|:        .:.:.|:       ..|.:..:|:.|.|..:..|:.:::..|:.:| .
  Rat   296 EGADSELEE--------EIAESSL-------PNVMESAYYFEQAGVGLGTDETYRIFLALKQLTD 345

  Fly   241 THPSIMQCRFWGCINGLKASYYIVEASLTREEIASRLVMMEEEMRQKQIPFPMRKDREDKPPPAH 305
            ||| |.:|||||.|.||:.:|.:.|......|       .|||:.::.|    .::|::      
  Rat   346 THP-IQRCRFWGKILGLEMNYIVAEVEFRDGE-------DEEEVEEEGI----AEERDN------ 392

  Fly   306 IGPELTPGIYGWEEFPPEELEKMKPKAAPVPLVEEMELYDIPPEFIGKGCNRYSYFVVNSLFDDW 370
                      |..|....|.:::     |.||.:..:.  ||.|....|.|:|.|||.:.....|
  Rat   393 ----------GGSEAGDSEEDEL-----PKPLYKAPQA--IPKEESRTGANKYVYFVCSEPGRPW 440

  Fly   371 IELPIVTPRQIVVSRQIKKFLTGDLEADVISYPCFPGKEKHYLRTLIGRITAGTYIAPVGYYRRM 435
            :.||.|||.|||.:|:||||.||.|:|.::|||.|||.|.:|||..|.||:|||:::|:|:|:  
  Rat   441 VRLPSVTPAQIVTARKIKKFFTGRLDAAIVSYPPFPGNESNYLRAQIARISAGTHVSPLGFYQ-- 503

  Fly   436 TKKEQRMFDGEEEEEGEEEEEEEEEEEFNEGEE-EQIEDNDVMLLKNEKYEAEPLGSLATPVAWV 499
                   |.   ||||||||.|...:.:.|..: |.|:..|::         |.|.:      ||
  Rat   504 -------FG---EEEGEEEEVEGGRDSYEENSDFEGIQVIDLV---------ESLSN------WV 543

  Fly   500 HVRSNILNQQGRVVWYDEEKARKEREKALALYLKMQMLGEMEEEVEEEEDEEEGEEEGEEEGMIE 564
            |....|| .|||..|::..:                         ::||:|||.||:|||...:|
  Rat   544 HHAQYIL-PQGRCNWFNPTQ-------------------------KDEEEEEEDEEKGEEPDYVE 582

  Fly   565 GFNQPELGPSILSSCANDMNPEVPVSWLARMTSKYTNQKERMLVMQSNVWPGAYTFIFEKTCESI 629
                .|:||.:|:..:.|:..:...||..|::|....| ..:.|::||:|||||.|...|..|::
  Rat   583 ----QEVGPPLLTPISEDLEIQNIPSWTTRLSSNLVPQ-YAIAVLRSNLWPGAYAFSNGKKFENL 642

  Fly   630 YLGWGHKYYARNIPFKHLPMVQEEFPHNPEDFVEANDPTVEEEEAYKAWLLRKQQKAEYVAEDIE 694
            |:||||||...|......|.|.:|:|..|| ..|.:||:||||:|::.    .|:.|...||:.|
  Rat   643 YIGWGHKYSVENYTPPGPPPVYQEYPSGPE-IAEMDDPSVEEEQAFRI----TQEAAALSAEENE 702

  Fly   695 DYDDDEFAD 703
            :.:|::..|
  Rat   703 ETEDEDNDD 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3121NP_611869.1 Radial_spoke 83..679 CDD:282555 191/607 (31%)
Rsph4aXP_003752009.1 Radial_spoke 209..691 CDD:282555 190/609 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C356381577
eggNOG 1 0.900 E1_28KDA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003149
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129136
Panther 1 1.100 LDO PTHR13159
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.