DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3121 and Rsph6a

Sequence 1:NP_611869.1 Gene:CG3121 FlyBaseID:FBgn0034957 Length:708 Species:Drosophila melanogaster
Sequence 2:XP_008757131.1 Gene:Rsph6a RGDID:1306786 Length:705 Species:Rattus norvegicus

Alignment Length:732 Identity:221/733 (30%)
Similarity:326/733 (44%) Gaps:204/733 (28%)


  Fly    42 PECSNVTSSSSSSTTTISIGAFD------------SQCNLHNARNPEAP-------NIGY----- 82
            ||..::.....|:....:.|..|            ||...|.....:.|       ::|:     
  Rat   113 PEGQSLLEQLESNYQDSASGVLDQFNLYSREDDTFSQATQHGPYMRDDPTLHLGPSDLGFMPFVG 177

  Fly    83 --------ELNV--AKSILQKYSTLSGDNLFDHLSDIIKRVIDERPPNVIDFFEEFSRNVREQKF 137
                    ||.|  ||:.|.:.|.....:|::||.:::.:::::||.:.:...|..:|..:.:.|
  Rat   178 EVPDPEPRELAVQNAKAYLLQTSVSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTTQWEWF 242

  Fly   138 HL--------PERFPPSGVFDEVRSFRVAKKILQSMKLPYV---VEGEDLMGEDLSVEDLRTNED 191
            |.        ||..|         ::.:|:|    .|..::   .|||..|.|:           
  Rat   243 HPKLDTLRDDPEMQP---------TYEMAEK----QKALFIRGGGEGEQEMEEE----------- 283

  Fly   192 MRIVIDDSMRYFVTFNERVQQLQFYWTQCGFSISNDDIFQLASAMNRLQTHPSIMQCRFWGCING 256
               |.|..:       ..:.:..||:.|.|..:|:|:.|::..|:.:|.....|..|||||.|.|
  Rat   284 ---VTDSPV-------PNIMETAFYFEQAGVGLSSDESFRIFLALRQLVEQQPIHSCRFWGKILG 338

  Fly   257 LKASYYIVEASLTREEIASRLVMMEEEMRQKQIPFPMRKDREDKPPPAHIGPEL--TPGIYGWEE 319
            |..||.:.|... ||.        |||..::::...|.            |.|:  |.|    ||
  Rat   339 LSRSYLVAEVEF-REG--------EEEGEEEEVEEMME------------GGEVLETHG----EE 378

  Fly   320 FPPEELEKM-----KPKAAPVPLVEEMELYDIPPEFIGKGCNRYSYFVVNSLFDDWIELPIVTPR 379
            ...|:.||:     ||:..|.|:        ||.|....|.|:|.|||.|.....|..||.|||.
  Rat   379 EGEEDEEKVVDAVPKPQWKPPPV--------IPKEESRSGANKYLYFVCNEPGRPWTRLPHVTPA 435

  Fly   380 QIVVSRQIKKFLTGDLEADVISYPCFPGKEKHYLRTLIGRITAGTYIAPVGYYRRMTKKEQRMFD 444
            |||.:|:||||.||.|:..|||||.|||.|.:|||..|.||:|.|:|:|:|:|            
  Rat   436 QIVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAATHISPLGFY------------ 488

  Fly   445 GEEEEEGEEEEEEEEE-----EEFNEGEEEQIEDNDVMLLKNEKYEAEPLGSLATPVA-WVHVRS 503
                :.||||.:||||     :.|.|               |..:|..|:..|...:| |||...
  Rat   489 ----QFGEEEGDEEEEGGAGRDSFEE---------------NPDFEGIPVLELVDSMANWVHHTQ 534

  Fly   504 NILNQQGRVVWYDEEKARKEREKALALYLKMQMLGEMEEEVEEEEDEEEGEEEGEEEGMIEGFNQ 568
            :|| .|||..|.:                .||...|.||..||||..:||.||.|:         
  Rat   535 HIL-PQGRCTWVN----------------PMQKTEEEEELGEEEEKADEGMEEVEQ--------- 573

  Fly   569 PELGPSILSSCAND-----MNPEVPVSWLARMTSKYTNQKERMLVMQSNVWPGAYTFIFEKTCES 628
             |:||.:|:..:.|     ::|     |..|::...:.|.. :.|::||:|||||.:...|..|:
  Rat   574 -EVGPPLLTPLSEDAEIMHLSP-----WTTRLSCSLSPQYS-VAVVRSNLWPGAYAYATGKKFEN 631

  Fly   629 IYLGWGHKYYARNI-PFKHLP-MVQEEFPHNPEDFVEANDPTVEEEEAYKAWLLRKQQKAEYVAE 691
            :|:||||||...|. |.  || ::|:|:|..|| .:|.:|||||||:|.||    .|::|...||
  Rat   632 LYIGWGHKYSPENFNPM--LPALIQQEYPSGPE-IMEMSDPTVEEEQALKA----AQEQALAAAE 689

  Fly   692 DIEDYDDDEFADQYDDD 708
            : |:.||:|..|:..:|
  Rat   690 E-EEEDDEEDEDEDLED 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3121NP_611869.1 Radial_spoke 83..679 CDD:282555 201/629 (32%)
Rsph6aXP_008757131.1 Radial_spoke 188..678 CDD:282555 197/624 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C356377723
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I2997
OMA 1 1.010
OrthoDB 1 1.010 D166599at33208
OrthoFinder 1 1.000 FOG0003149
OrthoInspector 1 1.000 T619201
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13159
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.