DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3121 and rsph4a

Sequence 1:NP_611869.1 Gene:CG3121 FlyBaseID:FBgn0034957 Length:708 Species:Drosophila melanogaster
Sequence 2:XP_001923770.1 Gene:rsph4a ZFINID:ZDB-GENE-030131-7437 Length:524 Species:Danio rerio

Alignment Length:634 Identity:194/635 (31%)
Similarity:297/635 (47%) Gaps:142/635 (22%)


  Fly    88 KSILQKYSTLSGDNLFDHLSDIIKRVIDERPPNVIDFFEEFSRNVREQKFHLPERFPPSGVFDEV 152
            |:.:.|.||.:..||:|||..::.||:||||.|.:|..|:.|..::.......:        |.:
Zfish    20 KAFMMKNSTKTNLNLYDHLVRLLTRVMDERPENAVDVMEDMSLELKGSVLQEKQ--------DTL 76

  Fly   153 R---SFRVAKKILQSMKLPYVVEGEDLMGEDLSVEDLRTNEDMRIVIDDSMRYFVTFNERVQQLQ 214
            |   |...|..:.:..|..::....|  |.|...|          ::|..:       ..|.:|.
Zfish    77 RDSPSSSPALVLAEQQKTLFMHTAGD--GGDHEEE----------LVDSPL-------PNVAELA 122

  Fly   215 FYWTQCGFSISNDDIFQLASAMNRLQTHPSIMQCRFWGCINGLKASYYIVEASLTREEIASRLVM 279
            |::.|.|..:..::|.::..|:..|.....:::|||||.|.|.:.:|.:.|.             
Zfish   123 FFFEQAGVGLGREEIQRIFLALKHLVDTQLLLRCRFWGKILGTQGNYLVAEG------------- 174

  Fly   280 MEEEMRQKQIPFPMRKDREDKPPPAHIGPELTPGIYGWEEFPPEELEKMKPKAA------PVPLV 338
               |.|:.:       ..||:      |.|.||.    |:...|||::.|.:|.      |:|..
Zfish   175 ---EFREGE-------GEEDE------GTEQTPE----EDEREEELQEGKDEAELVEAADPLPKS 219

  Fly   339 EEMELYDIPPEFIGKGCNRYSYFVVNSLFDDWIELPIVTPRQIVVSRQIKKFLTGDLEADVISYP 403
            .......:|.|....|.|:::|||.......|:.||:|||.||.|:|||::|.||.|:|.|:|||
Zfish   220 TYKPSASVPKEGNHTGANKFTYFVCQEPGMPWVRLPVVTPVQITVARQIRRFFTGKLDAPVVSYP 284

  Fly   404 CFPGKEKHYLRTLIGRITAGTYIAPVGYYRRMTKKEQRMFDGEEEEEGEEEEEEEEEEEFNEGEE 468
            .|||.|.:|||..|.||:|||:::|:|:|:          .||:|.|.:...:..||....||  
Zfish   285 PFPGNEANYLRAQIARISAGTHVSPLGFYQ----------FGEDEGEDDGLRDSFEENPTFEG-- 337

  Fly   469 EQIEDNDVMLLKNEKYEAEPLGSLATPVAWVHVRSNILNQQGRVVWYDEEKARKEREKALALYLK 533
              |:.|::         ||.|.      .|||...:||. |||.||.:..|              
Zfish   338 --IQVNEM---------AESLN------LWVHHVQHILT-QGRCVWVNVTK-------------- 370

  Fly   534 MQMLGEMEEEVEEEEDEEEGEEEGEEEGMIEGFNQPELGPSILSSCAND--MNPEVPVSWLARMT 596
             :.:.:::|:.|:||.|||.:|           .:||:||.:|:..:.|  :|...|  |.:.|:
Zfish   371 -KPVDDVDEDAEDEEREEEPDE-----------LEPEVGPPLLTPLSEDAKLNDTPP--WSSMMS 421

  Fly   597 SKYTNQKERMLVMQSNVWPGAYTFIFEKTCESIYLGWGHKYYARNIPFKHL--PMVQEEFPHNPE 659
            |....| ..:.|::||:|||||.:...|...:||:|||.|:...  ||..:  |..|.|||..||
Zfish   422 SNIIPQ-FAIAVLRSNLWPGAYAYCSGKNFGNIYIGWGLKFIGE--PFTPVLPPPPQSEFPSGPE 483

  Fly   660 DFVEANDPTVEEEEAYKAWLLRKQQKAEYVAEDIEDYDDDEFADQYDDD 708
            . .||.||:||||:|.|| .:.:|..|....||:|:.:|:      |||
Zfish   484 T-TEALDPSVEEEQALKA-AMEEQTAAMEETEDLEEEEDE------DDD 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3121NP_611869.1 Radial_spoke 83..679 CDD:282555 185/604 (31%)
rsph4aXP_001923770.1 Radial_spoke 18..503 CDD:309724 185/606 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C356377072
eggNOG 1 0.900 E1_28KDA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3312
OMA 1 1.010
OrthoDB 1 1.010 D166599at33208
OrthoFinder 1 1.000 FOG0003149
OrthoInspector 1 1.000 T1054578
orthoMCL 1 0.900 OOG5_129136
Panther 1 1.100 LDO PTHR13159
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6491
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.