DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and PSK2

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_014597.1 Gene:PSK2 SGDID:S000005405 Length:1101 Species:Saccharomyces cerevisiae

Alignment Length:920 Identity:210/921 (23%)
Similarity:381/921 (41%) Gaps:190/921 (21%)


  Fly    34 MGSHSQ---SRQNSSGMLNMMDASSFSMPPPNLHSSKVINPNKAIFTIDANTG--QIF------- 86
            :||.||   ..:....::::.|..      |....|::::|    ||...|:|  .||       
Yeast   245 LGSKSQYNEYEEKHDDIVSLADIK------PQQDYSRILHP----FTSAKNSGPEAIFTCSQQYP 299

  Fly    87 ----IVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRVVLLSGK---VIE 144
                ..|:.||...|.:...::.....||::  |:|....|.::....|:.:.::.:|:   :::
Yeast   300 WNFKAANDLACLTFGISKNVIKALTLLDLIH--TDSRNFVLEKIMNAEDDNQEIVFTGETIPIVQ 362

  Fly   145 MKTKSGGK----ILVSLWIRQISSDGRHIAVAEPVERHICHISTD-RSGVITSVDSTT------- 197
            ..:.|...    |..|||.::  .:|..:.|.|........:..: |...:.|:..||       
Yeast   363 PNSTSNNNVPNLIWASLWAKR--KNGLLVCVFEKTPCDYIDVMLNLRDFSVDSIIDTTHFLENFD 425

  Fly   198 --------------ATIFFYESVESVVGVS-----IVTLIPFIKLPDPDSREIPKSLRKQRATGR 243
                          .|:.|...:..:..||     ::..:.|.|:...|...:|.|:   |....
Yeast   426 KKKQQESTSPMTEKKTVKFANEIHDIGSVSHSLSKLIDDVRFGKVFSADDDLLPLSI---RVANH 487

  Fly   244 TTDNVKFPL-CLLIALDEDASAGYSHSGKTGLNITVWVFQN-----------LSGLIVVDD-IGN 295
            ..:...|.| ||              |......:|..|.:|           .:||.:||. ..:
Yeast   488 VNEERYFTLNCL--------------SENIPCAVTTSVLENEIKLKIHSLPYQAGLFIVDSHTLS 538

  Fly   296 ILMCNQPFSLLMFGYGQDKIMNMHISAILPNFGKDSREEKSPNVSNTSITSNDWEPDTDPLVV-- 358
            :|..|:..:..|||....::....::.::|     |..:....::.|....|...|:...||:  
Yeast   539 LLSFNKSVAKNMFGLRLHELAGSSVTKLVP-----SLADMISYINKTYPMLNITLPENKGLVLTE 598

  Fly   359 ------------DNDS-----SLQSCKKSSTNRTAPNNEQSSVGDAHLSCNLENSSGLFCDLRQP 406
                        |.||     .|..|.|           ..::....:...:.|::.:...:...
Yeast   599 HFFRKIEAEMHHDKDSFYTSIGLDGCHK-----------DGNLIKVDVQLRVLNTNAVLLWITHS 652

  Fly   407 DDCTIDDILTPVNASNSFPADEFEV----GSQSQVNESSLDKAK------------------SAS 449
            .|..|::..|..:.......:|.:|    ||.|..::.|.:|..                  |.|
Yeast   653 RDVVIENYTTVPSQLPMLKENEIDVVGSRGSSSASSKKSSEKIPVNTLKAMADLSISSAETISNS 717

  Fly   450 TETCDASGSNPATR---------LLSSINGSFVGEAIHADGSVIEVVYSVLLQILPCSNRVYCIW 505
            .:..|.:..|...|         :.|:.|.::..:....|..  |:.:.:.|..:...::...: 
Yeast   718 DDEVDLNQVNEKLRETSCGKVRGIESNDNNNYDDDMTMVDDP--ELKHKIELTKMYTQDKSKFV- 779

  Fly   506 VCRNPSTRLDGEKYNYANLTSTFNSMASTVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLG 570
              ::.:.::| ||:           :...:|...|:.||....:...|.::|........|..:|
Yeast   780 --KDDNFKVD-EKF-----------IMRIIEPINGEEIKKETNELDKRNSTLKATYLTTPEANIG 830

  Fly   571 DYSKY-----YTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEI 630
            ...:.     :|.::.:|.||||.||:...|.:..:|:.|.|.||::.....|:.|....:|.||
Yeast   831 SQKRIKKFSDFTILQVMGEGAYGKVNLCIHNREHYIVVIKMIFKERILVDTWVRDRKLGTIPSEI 895

  Fly   631 HLLQTLN---HKNIVSVLDVFENDLFYQLVMEKHG--SGMDLWTFIERRPLMDEKLGSYIFRQVA 690
            .::.|||   .:||:.:||.||:|.:|.:....||  ..:||:..||.:..|.|.....:|:||.
Yeast   896 QIMATLNKNSQENILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFKKDMVEHEAKLVFKQVV 960

  Fly   691 DAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNR 755
            .::.:||:|.|:||||||||:|:|.:..:||||||||.:::.|. |..|.||.:|.:||||.|:.
Yeast   961 ASIKHLHDQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGP-FDVFVGTMDYAAPEVLGGSS 1024

  Fly   756 YVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKA--VSEQLSRLLSSMLNKDPKYRCT 818
            |.|...:||||||.||.:::.|||:.:::|.|:.|::..|:  |||:...|:..:|.::...|.|
Yeast  1025 YKGKPQDIWALGVLLYTIIYKENPYYNIDEILEGELRFDKSEHVSEECISLIKRILTREVDKRPT 1089

  Fly   819 MHQLITDPWL 828
            :.::..|.||
Yeast  1090 IDEIYEDKWL 1099

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 23/115 (20%)
PAS 74..169 CDD:238075 23/115 (20%)
PAS_9 286..>335 CDD:290162 11/50 (22%)
PAS 286..>325 CDD:238075 9/40 (23%)
STKc_PASK 575..828 CDD:270906 100/265 (38%)
S_TKc 576..828 CDD:214567 100/259 (39%)
PSK2NP_014597.1 STKc_PASK 840..1099 CDD:270906 100/260 (38%)
Pkinase 841..1099 CDD:278497 100/259 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337055717
eggNOG 1 0.900 E2759_KOG1152
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634727
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 O PTHR24346
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.