DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and PSK1

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_009385.2 Gene:PSK1 SGDID:S000000015 Length:1356 Species:Saccharomyces cerevisiae

Alignment Length:966 Identity:228/967 (24%)
Similarity:386/967 (40%) Gaps:282/967 (29%)


  Fly    73 KAIFTI-DANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRVV 136
            :||||. ..:..|....|:.||.:.|.:...:|.....||::..:.:.:..    ::...||:.:
Yeast   461 QAIFTCSQEDPWQFRAANDLACLVFGISQNAIRALTLMDLIHTDSRNFVLH----KLLSTEGQEM 521

  Fly   137 LLSGKVI---EMKTKSGGKIL-VSLWIRQISSDGRHIAVAEPVERHICH-----ISTDRSGVITS 192
            :.:|::|   :.:|.|..|:: .|.|.::  .:|..:.|.|.|.   |.     ::.|..|....
Yeast   522 VFTGEIIGIVQPETLSSSKVVWASFWAKR--KNGLLVCVFEKVP---CDYVDVLLNLDDFGAENI 581

  Fly   193 VD-----------STTATIFFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATG---- 242
            ||           |:::|:...:...|..|..:...:        :.:.:.||..|..:|.    
Yeast   582 VDKCELLSDGPTLSSSSTLSLPKMASSPTGSKLEYSL--------ERKILEKSYTKPTSTENRNG 638

  Fly   243 --------------------RTTDNVKFPLCL---------LIALDEDASAGY------------ 266
                                |:..:|||...:         |..|.:|...|.            
Yeast   639 DENQLDGDSHSEPSLSSSPVRSKKSVKFANDIKDVKSISQSLAKLMDDVRNGVVFDPDDDLLPMP 703

  Fly   267 ----SHSGKT--------GLNITVWVFQNL---------------SGLIVVDD-IGNILMCNQPF 303
                :|..:|        ..||...|...:               :||.:||. ..:|:..|:..
Yeast   704 IKVCNHINETRYFTLNHLSYNIPCAVSSTVLEDELKLKIHSLPYQAGLFIVDSHTLDIVSSNKSI 768

  Fly   304 SLLMFGYGQDKIMNMHISAILPNFGKDSR--EEKSP----------------------------- 337
            ...||||...:::...|:.|:|:|.|..:  .:|.|                             
Yeast   769 LKNMFGYHFAELVGKSITEIIPSFPKFLQFINDKYPALDITLHKNKGLVLTEHFFRKIQAEIMGD 833

  Fly   338 --------------------------NVSNTSIT------SND---WEPDTDP----LVVDNDSS 363
                                      .|.|:.:.      |.|   .|.:|:|    ::.:::.|
Yeast   834 RKSFYTSVGIDGLHRDGCEIKIDFQLRVMNSKVILLWVTHSRDVVFEEYNTNPSQLKMLKESELS 898

  Fly   364 LQSCKKSSTNRTAPNNEQSSVGDAHLSCNLENSSGLFCDLRQPDDCTIDDILTPVNASNSFPADE 428
            |.|...||.:.:..::.:.|.|      .|::.|.|         .|.:|:....|..      :
Yeast   899 LMSSASSSASSSKKSSSRISTG------TLKDMSNL---------STYEDLAHRTNKL------K 942

  Fly   429 FEVGSQSQV-NESSLDKAKSASTETCDASG----SNP-------ATRLLSSINGSFVGEA-IHAD 480
            :|:|..|:. ::|:|.:.:....|....||    ::|       ..|:.|.....||.|. ...|
Yeast   943 YEIGDDSRAHSQSTLSEQEQVPLENDKDSGEMMLADPEMKHKLELARIYSRDKSQFVKEGNFKVD 1007

  Fly   481 GSVIEVVYSVLLQILPCSNRVYCIWVCRNPSTR--------------LDGEKYNYANLTSTFNSM 531
            .::|....|:                  :|||.              |:.||....|.|.  |.:
Yeast  1008 ENLIISKISL------------------SPSTESLADSKSSGKGLSPLEEEKLIDENATE--NGL 1052

  Fly   532 ASTVEQSLGQVIKTTAAQNSSRPNSLSL------------VSKYEDELYLGDYSKYYTSIRQIGR 584
            |.:.:...| :|.|.  :..::|.|..|            |.|:.|          :.|::::|.
Yeast  1053 AGSPKDEDG-IIMTN--KRGNQPVSTFLRTPEKNIGAQKHVKKFSD----------FVSLQKMGE 1104

  Fly   585 GAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLN---HKNIVSVLD 646
            ||||.||:.....:|.:|:.|.|.||::.....|:.|....:|.||.::.|||   |:||:.:||
Yeast  1105 GAYGKVNLCIHKKNRYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENILRLLD 1169

  Fly   647 VFENDLFYQLVMEKHGSG--MDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDE 709
            .||:|.:|.:....||..  :||:..||.:..|.|.....||:||...:.:||:|.|:|||||||
Yeast  1170 FFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDE 1234

  Fly   710 NIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLM 774
            |:|:|....:|:||||||.:::.|. |..|.||.:|.:||||.||.|.|...:|||:|:.||.::
Yeast  1235 NVIVDSKGFVKIIDFGSAAYVKSGP-FDVFVGTIDYAAPEVLGGNPYEGQPQDIWAIGILLYTVV 1298

  Fly   775 FFENPFIDVEETLKAEIQIPKA--VSEQLSRLLSSMLNKDPKYRCTMHQLITDPWL 828
            |.||||.:::|.|:.:::...|  |||....|:.|:||:....|.|:..:..|.||
Yeast  1299 FKENPFYNIDEILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDINNDKWL 1354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 22/100 (22%)
PAS 74..169 CDD:238075 22/100 (22%)
PAS_9 286..>335 CDD:290162 15/52 (29%)
PAS 286..>325 CDD:238075 12/40 (30%)
STKc_PASK 575..828 CDD:270906 103/260 (40%)
S_TKc 576..828 CDD:214567 103/259 (40%)
PSK1NP_009385.2 STKc_PASK 1095..1354 CDD:270906 104/270 (39%)
Pkinase 1096..1354 CDD:278497 103/259 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337055764
eggNOG 1 0.900 E2759_KOG1152
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634727
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 LDO PTHR24346
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.