| Sequence 1: | NP_611864.1 | Gene: | Pask / 37824 | FlyBaseID: | FBgn0034950 | Length: | 985 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_568860.1 | Gene: | CIPK21 / 835868 | AraportID: | AT5G57630 | Length: | 416 | Species: | Arabidopsis thaliana |
| Alignment Length: | 443 | Identity: | 111/443 - (25%) |
|---|---|---|---|
| Similarity: | 189/443 - (42%) | Gaps: | 94/443 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 560 VSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCK 624
Fly 625 EVPIEIHLLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQV 689
Fly 690 ADAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGN 754
Fly 755 RYVGPELEIWALGVTLYVLMFFENPFID------VEETLKAEIQIPKAVSEQLSRLLSSMLNKDP 813
Fly 814 KYRCTMHQ-LITDPWL------------------TQEVNPSTFSFSWIVPCKAHEANPNLYFSGY 859
Fly 860 LYSS------TSVLSTISPQESFSHIEESSIGGSDDARLASHRTGHKLCVNEAKHNKM------- 911
Fly 912 ------DTLYAKQFQ-------LNTSVSNHELRVSLPDSSHTEIGGSICSSKS 951 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pask | NP_611864.1 | PAS_9 | 74..169 | CDD:290162 | |
| PAS | 74..169 | CDD:238075 | |||
| PAS_9 | 286..>335 | CDD:290162 | |||
| PAS | 286..>325 | CDD:238075 | |||
| STKc_PASK | 575..828 | CDD:270906 | 75/259 (29%) | ||
| S_TKc | 576..828 | CDD:214567 | 75/258 (29%) | ||
| CIPK21 | NP_568860.1 | PKc_like | 11..263 | CDD:419665 | 79/271 (29%) |
| CIPK_C | 297..411 | CDD:213380 | 26/135 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||