DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and CIPK21

DIOPT Version :9

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_568860.1 Gene:CIPK21 / 835868 AraportID:AT5G57630 Length:416 Species:Arabidopsis thaliana


Alignment Length:443 Identity:111/443 - (25%)
Similarity:189/443 - (42%) Gaps:94/443 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 VSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCK 624
            :.|||    :|         |.||.|.:..|.:.:..::...|..| |:.:.|..|..::|    
plant     9 IGKYE----IG---------RTIGEGNFAKVKLGYDTTNGTYVAVK-IIDKALVIQKGLES---- 55

  Fly   625 EVPIEIHLLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQV 689
            :|..||..::.|||.|||.:.:|........:||| :.||..|...:.|:. |.|.....:|:|:
plant    56 QVKREIRTMKLLNHPNIVQIHEVIGTKTKICIVME-YVSGGQLSDRLGRQK-MKESDARKLFQQL 118

  Fly   690 ADAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGN 754
            .|||:|.|.:.:.|||:|.:|:::|....:|:.|||.:...:.|...||..|:..|.:||::...
plant   119 IDAVDYCHNRGVYHRDLKPQNLLLDSKGNLKVSDFGLSAVPKSGDMLSTACGSPCYIAPELIMNK 183

  Fly   755 RYVGPELEIWALGVTLYVLMFFENPFID------VEETLKAEIQIPKAVSEQLSRLLSSMLNKDP 813
            .|.|..:::|:.||.|:.|:....||.|      .::.|:|:...|...:.:..||:.::|:.:|
plant   184 GYSGAAVDVWSCGVILFELLAGYPPFDDHTLPVLYKKILRADYTFPPGFTGEQKRLIFNILDPNP 248

  Fly   814 KYRCTMHQ-LITDPWL------------------TQEVNPSTFSFSWIVPCKAHEANPNLYFSGY 859
            ..|.|:.: :|.|.|.                  ..|:|.:|.|.::|...:....:.:|..||.
plant   249 LSRITLAEIIIKDSWFKIGYTPVYHQLSDSIKDNVAEINAATASSNFINAFQIIAMSSDLDLSGL 313

  Fly   860 LYSS------TSVLSTISPQESFSHIEESSIGGSDDARLASHRTGHKLCVNEAKHNKM------- 911
            ...:      |.:.|..:.||:...||.::             |...|.|...||.|:       
plant   314 FEENDDKRYKTRIGSKNTAQETIKKIEAAA-------------TYVSLSVERIKHFKVKIQPKEI 365

  Fly   912 ------DTLYAKQFQ-------LNTSVSNHELRVSLPDSSHTEIGGSICSSKS 951
                  |.|.|:..:       :..|.|..|||:.:          ..|.|.|
plant   366 RSRSSYDLLSAEVIEVTPTNCVIEISKSAGELRLYM----------EFCQSLS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 75/259 (29%)
S_TKc 576..828 CDD:214567 75/258 (29%)
CIPK21NP_568860.1 PKc_like 11..263 CDD:419665 79/271 (29%)
CIPK_C 297..411 CDD:213380 26/135 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.