DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and CPK27

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_192379.2 Gene:CPK27 AraportID:AT4G04700 Length:485 Species:Arabidopsis thaliana

Alignment Length:283 Identity:91/284 (32%)
Similarity:145/284 (51%) Gaps:32/284 (11%)


  Fly   569 LGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKE-VPIEIHL 632
            |.|.:|.|....::|||.:|........|.......|.|||.||      |..:|:| |..||.:
plant    21 LVDITKIYILGEELGRGNFGLTRKCVEKSTGKTFACKTILKTKL------KDEECEEDVKREIRI 79

  Fly   633 LQTLN-HKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMD------EKLGSYIFRQVA 690
            ::.|: ..|||...:.:|:.....:|||..|.| :|:..|  ..|.|      ||..:.|.|.:.
plant    80 MKQLSGEPNIVEFKNAYEDKDSVHIVMEYCGGG-ELYDKI--LALYDVGKSYSEKEAAGIIRSIV 141

  Fly   691 DAVNYLHEQKILHRDIKDENIII---DQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLA 752
            :.|...|...::|||:|.||.::   |.|.|:|:||||.:.|:||||.:....|:..|.:||||.
plant   142 NVVKNCHYMGVMHRDLKPENFLLTSNDDNATVKVIDFGCSVFIEEGKVYQDLAGSDYYIAPEVLQ 206

  Fly   753 GNRYVGPELEIWALGVTLYVLMFFENPFI-DVEETLKAEIQ-IPKAVSEQ--------LSRLLSS 807
            ||  .|.|.:||:.|:.||:|:..::||: :.|..:..||: :....||:        ...|:..
plant   207 GN--YGKEADIWSAGIILYILLCGKSPFVKEPEGQMFNEIKSLEIDYSEEPWPLRDSRAIHLVKR 269

  Fly   808 MLNKDPKYRCTMHQLITDPWLTQ 830
            ||:::||.|.:..:::..||:.:
plant   270 MLDRNPKERISAAEVLGHPWMKE 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 88/274 (32%)
S_TKc 576..828 CDD:214567 88/273 (32%)
CPK27NP_192379.2 S_TKc 28..290 CDD:214567 88/273 (32%)
STKc_CAMK 28..289 CDD:270687 87/272 (32%)
PTZ00184 325..468 CDD:185504
EFh 337..396 CDD:238008
EFh 411..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
10.910

Return to query results.
Submit another query.