DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and Lkb1

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001163606.1 Gene:Lkb1 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster

Alignment Length:611 Identity:135/612 (22%)
Similarity:233/612 (38%) Gaps:164/612 (27%)


  Fly   405 QPDDCTIDDILTPVNASNSFPADEFEVGSQSQVNESSLDKAKSASTETCDASGS----NPATRLL 465
            :||  .::|.:|.:.|:.:|   .::|.  |.:::.:..:.|..:.:..||...    ||...||
  Fly    61 EPD--PVEDEMTVLLANKNF---HYDVA--SDLDDDAFVELKEDTAQADDAGAGVGFYNPDELLL 118

  Fly   466 SSINGSFVGEAIH-----ADGSVIEVVYSVLLQILPCSNRVYCIWVCRNPSTRLDGEKYNYANLT 525
            .        :..|     .|...||.:..|.|.:   .|..:         .|:|.:...|    
  Fly   119 D--------DQPHPQVTWLDDDEIETLDRVTLDM---GNMFF---------NRVDSQDIIY---- 159

  Fly   526 STFNSMASTVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYV 590
                                     ..:..|:.:|.||    .:||.         :|.|:||.|
  Fly   160 -------------------------QQKKKSIKMVGKY----IMGDV---------LGEGSYGKV 186

  Fly   591 NMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVP-------IEIHLLQTLNHKNIVSVLDVF 648
            ..|..:.:...:..|.:.|.||           :.:|       .||.||:.|.|:::|.::||.
  Fly   187 KEAMNSENLCRLAVKILTKRKL-----------RRIPNGEQNVTREIALLKQLKHRHVVELVDVL 240

  Fly   649 END---LFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSY----IFRQVADAVNYLHEQKILHRDI 706
            .|:   ..| ||||....|  |...|:.:|  |:::..:    .|:|:.|.:.|||..:::|:||
  Fly   241 YNEEKQKMY-LVMEYCVGG--LQEMIDYQP--DKRMPLFQAHGYFKQLVDGLEYLHSCRVIHKDI 300

  Fly   707 KDENIIIDQNFTIKLIDFGSATFMEEGKFF------STFYGTTEYCSPEVLAGNR-YVGPELEIW 764
            |..|:::..:.|:|:.|||.|   |:...|      :|..|:..:..||:..|:. :.|.:::||
  Fly   301 KPGNLLLSLDQTLKISDFGVA---EQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGFKVDIW 362

  Fly   765 ALGVTLYVLMFFENPFID------VEETLKAEIQIPKAVSE---QLSRLLSSMLNKDPKYRCTMH 820
            :.|||||.|...:.||..      :|...:.:.:.|..:.|   ..:.|:..||..||..|.::.
  Fly   363 SSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSLQ 427

  Fly   821 QLITDPWLTQEVNPSTFSFSWIVPCKAHEANPNLYFSGYLYSSTSVLSTISPQESFSHIEESSIG 885
            ::..|.|...            .|.|.....|.....|..|.:    ||:.|     ::|....|
  Fly   428 EIRHDTWFRS------------APVKTGPPIPIPPLKGDKYRN----STVIP-----YLEAYHYG 471

  Fly   886 -GSDDARLASHRTGHKLCVNEAKHNKMDTLYAKQFQLNTSVSNHELRVSLPDSSHTEIGGSICS- 948
             ..:|.....|....:|....|.  ....:.|||.....:..:   ....|.:|......|:.: 
  Fly   472 TQEEDVYFTEHDVNQELARQAAA--AASEIRAKQSAAALAACH---TYEPPSTSAAAASNSLGNG 531

  Fly   949 SKSENDIFK---------NKLQPCVS 965
            |:.|..:.|         .||..|:|
  Fly   532 SREEAPVKKKGSALKRRAKKLTSCIS 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 77/283 (27%)
S_TKc 576..828 CDD:214567 77/282 (27%)
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 80/295 (27%)
STKc_LKB1 178..435 CDD:271021 77/276 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24346
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.