DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and PIM3

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001001852.2 Gene:PIM3 HGNCID:19310 Length:326 Species:Homo sapiens

Alignment Length:262 Identity:85/263 (32%)
Similarity:138/263 (52%) Gaps:9/263 (3%)


  Fly   572 YSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTL 636
            :.|.|.....:|.|.:|.|....|.:|.|.|..|.::||::...   .|.....||:|:.||:.:
Human    36 FEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEW---GSLGGATVPLEVVLLRKV 97

  Fly   637 ----NHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLH 697
                ..:.::.:||.||....:.||:|:.....||:.||..|..:||.|....|.||..||.:.|
Human    98 GAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCH 162

  Fly   698 EQKILHRDIKDENIIID-QNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPEL 761
            ...::||||||||:::| ::..:|||||||...::: ..::.|.||..|..||.:..:||.|...
Human   163 SCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKD-TVYTDFDGTRVYSPPEWIRYHRYHGRSA 226

  Fly   762 EIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDP 826
            .:|:|||.||.::..:.||...||.|:..:...:.||.:..:|:...|:..|..|.::.|:...|
Human   227 TVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHP 291

  Fly   827 WL 828
            |:
Human   292 WM 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 84/258 (33%)
S_TKc 576..828 CDD:214567 84/257 (33%)
PIM3NP_001001852.2 PKc_like 39..293 CDD:304357 84/258 (33%)
Pkinase 40..293 CDD:278497 84/257 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.