DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and KP78a

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_650066.1 Gene:KP78a FlyBaseID:FBgn0026064 Length:705 Species:Drosophila melanogaster

Alignment Length:310 Identity:90/311 (29%)
Similarity:155/311 (50%) Gaps:20/311 (6%)


  Fly   525 TSTFNSMASTVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGY 589
            ||...::.:|...:.||.:...|.   |..|:.|....|.:    |:.:..|..|:.:|:|.:..
  Fly    54 TSNATALPATPTVAAGQDLGDGAC---SSKNTDSKFQSYVN----GNGNGVYKIIKTLGKGNFAK 111

  Fly   590 VNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDLFY 654
            |.:|........|..|.|.|    :|....:|  :::..|:.:::.|||.|||.:..|.|::...
  Fly   112 VKLAIHVPTGREVAIKVIDK----TQLNTSAR--QKLYREVKIMKLLNHPNIVRLFQVIESERTL 170

  Fly   655 QLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQNFTI 719
            .|||| :.|..:|:..:.:...|.|:....||||:..|:.|.|.:.::|||:|.||:::||:..|
  Fly   171 YLVME-YASRGELFDHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRDLKAENLLLDQHMNI 234

  Fly   720 KLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFID-- 782
            |:.|||.....:......||.|:..|.:||:..|.:|.|||::.|:|||.||.|:....||..  
  Fly   235 KIADFGFGNTFDPNAQLETFCGSPPYAAPELFMGRKYAGPEVDAWSLGVVLYTLVSGSLPFDGGT 299

  Fly   783 ----VEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWL 828
                .|..|:.:.::|..:|.....|:...|..:|..|.::..:::|.|:
  Fly   300 LKELRERVLRGKYRVPYYISMDCENLMRKFLVLNPAKRTSLSAVMSDKWI 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 79/259 (31%)
S_TKc 576..828 CDD:214567 79/258 (31%)
KP78aNP_650066.1 PKc_like 98..349 CDD:304357 79/258 (31%)
S_TKc 98..349 CDD:214567 79/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24346
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.