DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and KP78b

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001163587.1 Gene:KP78b FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster

Alignment Length:449 Identity:115/450 (26%)
Similarity:191/450 (42%) Gaps:108/450 (24%)


  Fly   526 STFNSMASTVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYV 590
            ||..:..|...|::|....::..::|  |...|.|:        |:....|..|:.:|:|.:..|
  Fly    23 STTATPPSAAAQNVGGCFGSSGGRSS--PKFQSYVN--------GNGYGVYKIIKTLGKGNFAKV 77

  Fly   591 NMAFRNSDRLLVITKFILKEKL---CSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDL 652
            .:|........|..|.|.|..|   ..|.:.:         |:::::.|||.|||.:|.|.|::.
  Fly    78 KLAIHLPTGREVAIKLIDKTALNTIARQKLYR---------EVNIMKKLNHPNIVRLLQVIESER 133

  Fly   653 FYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQNF 717
            ...|||| :.||.:|:.::.:...|.|:....:|||:..|:.|.|.:.|:|||:|.||:::||..
  Fly   134 TLYLVME-YVSGGELFNYLVKNGRMRERDARVLFRQLVSAIEYCHSKSIVHRDLKAENLLLDQQM 197

  Fly   718 TIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFID 782
            .:|:.|||.:|..|......||.|:..|.:||:..|.:|.|||::.|:|||.||.|:....||..
  Fly   198 KLKIADFGFSTTFEPKAPLETFCGSPPYAAPELFRGKKYSGPEVDSWSLGVVLYTLVSGSLPFDG 262

  Fly   783 V------EETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWLT------------ 829
            .      :..|:.:.::|..||.:...|:...|..:|..|.::..::.|.|:.            
  Fly   263 TNLKELRDRVLRGKYRVPYYVSIECESLIRKFLVLNPTQRTSLSAVMADRWINMGYEQGNGLRPF 327

  Fly   830 QEVNPSTFSFSWIVPCKAHEANPNLYFSGYLYSSTSVLSTI--SPQESFSHIEESSIGGSDDARL 892
            ||           .|...|:.|           ..|:||.:  .|::    :|:|          
  Fly   328 QE-----------KPMDLHDVN-----------RLSLLSNMGHKPRD----VEQS---------- 356

  Fly   893 ASHRTGHKLCVNEAKHNKMDTLYAKQFQLNTSVSNHELRVSLPDSSHTEIGGSICSSKS 951
                         .|:.|.|.:|.....|:         |:.|.|       :.||.||
  Fly   357 -------------LKNQKFDDIYCTYMLLD---------VAKPRS-------TACSEKS 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 82/262 (31%)
S_TKc 576..828 CDD:214567 82/261 (31%)
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 82/261 (31%)
S_TKc 63..314 CDD:214567 82/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24346
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.