DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and pask

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:XP_003197983.1 Gene:pask ZFINID:ZDB-GENE-030131-1394 Length:1229 Species:Danio rerio

Alignment Length:1191 Identity:321/1192 (27%)
Similarity:493/1192 (41%) Gaps:345/1192 (29%)


  Fly     1 MEDQGDVTDQAAGKLSSSNAQCSRNRCA-NDDPIMGSHSQSRQNSSGMLNMMDASSFSMPPPNLH 64
            |:..|:  .|.:..::..|.|.|..:|: :..|  .|.:.|....|.:|..:    .|..|....
Zfish    56 MDTSGN--SQVSSSVAMRNLQISDLQCSLSVSP--SSAAASPVLESSLLRQL----ISTAPEKRS 112

  Fly    65 SSKVINPNKAIFTIDANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIE 129
            ::..||||||:.:|:::|.|:...|..||:|......:|..:....||  ::...:..|.|..::
Zfish   113 TALTINPNKAVLSINSSTSQVLDANEHACKLFECAYSDLMGRKLTSLL--RSSQMLEVLKEEALD 175

  Fly   130 GDEGRVVLLSGKVIEMKTKSGGKILVSLWIRQISSDGRHI--AVAEPVERHICHISTDRSGVITS 192
            .| |.:|.:|.||:...:.:|.:..||:|: ||....:.|  .:.|.|||...|::..::|.|.|
Zfish   176 SD-GNLVTISSKVVTAVSLTGAEFSVSVWL-QIPEKPQQILELLLERVERITAHVTFTQNGGILS 238

  Fly   193 VDSTTATIFFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKFPLCLLIA 257
            .|:|.|.:..|::.|.:.|:||::|:|.:::|. ..|..||.||.||...:....:..|.|  :.
Zfish   239 CDATFAHLNGYQAAEEMTGLSIISLMPSLQIPF-HCRTTPKVLRVQRLCVQARSGLVVPAC--VR 300

  Fly   258 LDEDASAGYS------HSGKTG------------LNITVWVFQNLSGLIVVDDIGNILMCNQPFS 304
            |....|.|.|      ..||:|            .:.:|.||...|.|:.:...|.|...|.|||
Zfish   301 LQAAVSCGRSPQQINGSGGKSGAGELLSPSAGVLYSGSVCVFAPSSCLLTLLPNGTIHSLNNPFS 365

  Fly   305 LLMFGYGQDKIMNMHISAILPNF------------------------------------------ 327
            .|:.||...:::..:::.::|.|                                          
Zfish   366 FLLLGYNSSQLLGKNVTYLIPAFYERVRAADRNNHPHESTSPSDSHAEPCRYSAGAKCPLANVLT 430

  Fly   328 -----------------------------------------------GKDSREEK---------S 336
                                                           |..::.||         |
Zfish   431 LSTDMTSTRDDQQDTCHPNTVLAGDSVMVHLAMRRRAGLVKGKRIFTGTSAKLEKENSVLSTMTS 495

  Fly   337 PNVSNTSITSNDWEPDTDPL---VVD-------NDSS------LQS------------------- 366
            |.|::|.:...|   ||..|   :||       :||:      ||:                   
Zfish   496 PAVTSTPLNGLD---DTTELCEQIVDVVPQTSGSDSANSTNALLQTFALVESLEVQKICTSADVS 557

  Fly   367 ----------------------CKKSSTN--RTAPN----------NEQSSVGDAH---LSCNLE 394
                                  ||:::.|  :.|||          ::|:.:.|:.   :|....
Zfish   558 ARCGPSEHHIAGQDSSKAPNPDCKEAAVNFCKYAPNPQSHTQTCLCSDQAQLQDSSFEVISLGSG 622

  Fly   395 NSSGL----------------------------FCDLRQPDDCTID-----DILTPVNASNSFPA 426
            :|||.                            |.||....|..:.     |:...|...| .||
Zfish   623 SSSGFCERLMGGSGPEKLDESQQGRQHLETGSTFLDLNSNGDVIVHAMSEMDLNDSVEIPN-VPA 686

  Fly   427 D-----------EFEVGSQSQVNESSLDKA------KSASTETCD-----AS------------- 456
            |           |........|.||.:|:|      :..:|:|.:     ||             
Zfish   687 DLNHSLTSCDTAELLRTPSPFVVESDVDEAAPVCPEQETTTKTPEDQERPASPQMKIPEQLPKNH 751

  Fly   457 ------------------------------GSNPATRL--LSSINGSFVGEAIHA-----DGSVI 484
                                          |..|||..  .:.:|.|......|.     ||:.|
Zfish   752 LTRVLEQWSTFSDHAVSRVLDLQKKGVLLPGDAPATSTPKKAKVNSSIPEGRTHVTCYNRDGAPI 816

  Fly   485 EVVYSVLLQILPCSNRVYCIWVCRNPSTRLDGEKYNYANLTSTFNSMASTVEQSLGQVIKTTAAQ 549
            ||...|....|...:.:.|:|        |.|......:..:..::|:.|        ::|..::
Zfish   817 EVQCDVRWVSLSSGSSLVCLW--------LSGSHLLLHHQEAPQSTMSPT--------LRTRTSE 865

  Fly   550 NSS-----RPNSL-SLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFIL 608
            .||     |.:|| |.|...:.....|.:.|.|..:|.||:||:|:|.:|.|.|....::.|||.
Zfish   866 QSSLVEAVRSDSLRSSVDLEQSGACEGHFEKNYRPLRSIGKGAFGFVWLASRRSSGEEMVVKFIR 930

  Fly   609 KEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIER 673
            |..:.|:..|...|...|..|:.:|..|.|.|:|.||:||||..|:||||||||.|:||:.||:.
Zfish   931 KSAVVSECWVDDPDLGRVTQEVAILVRLQHPNVVKVLEVFENQGFFQLVMEKHGEGLDLFEFIDM 995

  Fly   674 RPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFST 738
            :|.:||.|.||||||:..||:||..:|:||||||||||||:.||.|:|||||||..::.||.|.|
Zfish   996 QPRLDEPLASYIFRQLVAAVSYLRSKKVLHRDIKDENIIINSNFHIRLIDFGSAALLQPGKLFYT 1060

  Fly   739 FYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSR 803
            |.||.||||||||.||.|.|||||:|:|||.||.|:|.||||..|||||:|.:..|..:|..|..
Zfish  1061 FCGTLEYCSPEVLMGNPYEGPELEMWSLGVLLYTLLFSENPFCSVEETLQARLNPPCEISTDLYA 1125

  Fly   804 LLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEANPNLYFSGYLYSSTSVLS 868
            ||:.:|:.....|.|:.:|:...|:.|.:|.:.:|:..|.|......:..::.:..||:::    
Zfish  1126 LLAGLLHPAVDQRMTLEELLQSQWIQQPINLAEYSWRDIFPSSDDSKSSCVHRAEVLYTNS---- 1186

  Fly   869 TISPQESFSHIEESSIGGSDD 889
                :.:.|.:|::.||..||
Zfish  1187 ----ENNLSSLEDTPIGEDDD 1203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 25/95 (26%)
PAS 74..169 CDD:238075 25/95 (26%)
PAS_9 286..>335 CDD:290162 14/138 (10%)
PAS 286..>325 CDD:238075 10/39 (26%)
STKc_PASK 575..828 CDD:270906 133/253 (53%)
S_TKc 576..828 CDD:214567 133/252 (53%)
paskXP_003197983.1 PKc_like 898..1150 CDD:304357 133/252 (53%)
S_TKc 898..1150 CDD:214567 133/252 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337041929
eggNOG 1 0.900 E2759_KOG1152
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 411 1.000 Inparanoid score I1790
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153824at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1052764
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 LDO PTHR24346
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.