DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and Pask

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001009362.1 Gene:Pask RGDID:1306146 Length:1385 Species:Rattus norvegicus

Alignment Length:1313 Identity:343/1314 (26%)
Similarity:503/1314 (38%) Gaps:484/1314 (37%)


  Fly    15 LSSSNAQCSRNRCAND----DPIMGSHSQSRQNSSGMLNMMDASSFSMPPPNLHSSKVINPNKAI 75
            |::.|...|:..||..    |||.|....:  :...:|..: ||..|.|   |.|:.|.|||||:
  Rat    72 LAAQNICTSKLHCAATPDYADPIAGPLGST--SCCSLLRGL-ASGCSGP---LLSTPVCNPNKAV 130

  Fly    76 FTIDANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRVVLLSG 140
            ||:||.|.:|.:.|:|||.||||:|.:|..:.............:.:|:|..:|.| |...::.|
  Rat   131 FTVDAKTTEILVANDKACSLLGYSSHDLIGQKLTQFFLKSDSEVVEALSEEHVEAD-GHAAVVFG 194

  Fly   141 KVIEMKTKSGGKILVSLWIRQISSDGR--HIAVAEPVERHICHISTDRSGVITSVDSTTATIFFY 203
            .|:::.::||.||.||:||:::..|..  .:.|.|||||....::....|.|||.||..|.:..:
  Rat   195 TVVDIVSRSGEKIPVSVWIKRLQQDRGLCCVVVLEPVERVSAWVAFQSDGTITSCDSLFAHLHGF 259

  Fly   204 ESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKFPLCL---------LIALD 259
            .|.:.|||..::.|||.|:|| |..:.:||||:.||:.||..|...|||.|         .:|..
  Rat   260 TSPKDVVGQCVIDLIPSIQLP-PPGQHVPKSLKIQRSVGRARDGTTFPLSLKLKSKTSGKAVAES 323

  Fly   260 EDASAGYSHSGKTGLNITVWVFQNLSGLIVVDDIGNILMCNQPFSLLMFGYGQDKIMNMHISAIL 324
            |.||       :.|...:||||..:||||.:...|.|...|..|:|::||||:.:::..:|:.::
  Rat   324 EVAS-------EPGYQASVWVFCTISGLITLLPDGTIYGINHSFALMLFGYGKTELLGKNITCLI 381

  Fly   325 PNF------GKDSREEKSPNVSN-------------TSITSNDWE-------------------- 350
            |.|      ..|| ..:.|::.|             :|....|||                    
  Rat   382 PGFYHCMDLAYDS-SVQLPDLVNCLDIGSKSGPGEMSSDAKQDWELASGAQDPRIDVLTRGHMPS 445

  Fly   351 ----------------------------------------------------------------- 350
                                                                             
  Rat   446 QDETLKLRGGQVSPRTQTQLETGRHILPSCASQPSLGVDSSPVDGERSLPTDQRNVPKRNLLAHA 510

  Fly   351 --------PDT---DPLVVDNDSSLQ--------------------------------------- 365
                    |||   .|.|:...|.:|                                       
  Rat   511 EQLLSQTQPDTLEISPPVLKELSEIQKNISEESPLTHRKWLLSKAQKDTTKGSLPIHDEKLLLAS 575

  Fly   366 ------------------------------------SCK--------KSSTNRT----------- 375
                                                ||:        |..:||.           
  Rat   576 QHIHVLGKENPSAAESYREGLLAESRSKPVDAKPFASCEDSELLVPAKDRSNRADMSSLQQEAQL 640

  Fly   376 ---------APNN-EQSSVGDAHLSCNLENSSGLFC----------------------------- 401
                     :||. ..:::.:.|.:..:...|..:|                             
  Rat   641 ELMGISSPGSPNPWADATMPEPHTTGQIPGGSLTYCPQHRSEWILQQRGQDSAPSPSAMGCVFVG 705

  Fly   402 -------------DLRQPDDCTIDDILT---------------------PVNASNSF-------- 424
                         |..:...|.|.:.|:                     |..|..||        
  Rat   706 TPTLDEPWPGVRNDREELQTCLIKEQLSKSSFGGALGISCVELVPAEHPPFTAPVSFCDWGGRDL 770

  Fly   425 -------------------------PADEFEVGSQS----------------------------- 435
                                     .|.|.:|.|.|                             
  Rat   771 HASRSGSSSACYALATDLPGVLEAVEAQEADVSSYSWNLRELFLNDRTDRTPSHCSCTTSELSET 835

  Fly   436 ------------------------------------------------------QVNESSLDKAK 446
                                                                  :::..||..::
  Rat   836 PSLSGVGSDLDVGILHRQTSDILAHREMLLLSGTYFDLREGHRFQEMGAGHDGAELSNISLVSSE 900

  Fly   447 SASTETCDASGSNP---------------ATRLLSSI-----------------NGSFVGEAIHA 479
            ...|...::.|.:|               ..||.:.|                 .|.|.|...|.
  Rat   901 HYETSDIESLGCDPPIPDPGPNNMCLSAEKPRLSAQITSTPVAPGPTSLQQEIQEGIFSGSCYHR 965

  Fly   480 DGSVIEVVYSVLLQILPCSNRVYCIWVC-------RNPSTRLDGEKYNYANLTSTFNSMASTVEQ 537
            ||..:.|.:.|....|..|..::|.|:.       |:.:||   .:...|:|.|:.:||......
  Rat   966 DGLRLSVQFEVKRVQLQGSATLFCCWLVKDFLHSHRDSATR---TRLFLASLPSSTHSMPDLSGS 1027

  Fly   538 SLGQVIKTTA-AQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLL 601
            |.|::::... .:.|..|..|..::..|     |:||..|.::|.:|.||:|:|..|........
  Rat  1028 SFGEMLRAKPWFEESPTPAELEGLAACE-----GEYSHKYNTLRPLGSGAFGFVWTAVEKEGNKE 1087

  Fly   602 VITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMD 666
            |:.|||.|||:.....|:......||:||.:|..:.|.||:.::|||||..|:||||||||||:|
  Rat  1088 VVVKFIKKEKVLEDCWVEDPKLGRVPLEISILSKVEHANIIKIVDVFENQGFFQLVMEKHGSGLD 1152

  Fly   667 LWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSATFME 731
            |:.||:|.|.:||.|.||||||:..||.||..|.|:|||||||||:|.::|||||||||||.::|
  Rat  1153 LFAFIDRHPCLDEPLASYIFRQLVSAVRYLRSQGIIHRDIKDENIVIAEDFTIKLIDFGSAAYLE 1217

  Fly   732 EGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKA 796
            :||.|.||.||.|||:||||.||.|.|||||:|:||||||.|:|.||||.:||||::|.|..|..
  Rat  1218 KGKLFYTFCGTIEYCAPEVLIGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEAVIHPPFL 1282

  Fly   797 VSEQLSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEANPNLYFSGYLY 861
            ||::|..|||.:|...|:.|.|:.:||.|||:||.||..  :::|...|:..:..     ||.:.
  Rat  1283 VSQELMSLLSGLLQPCPEQRTTLEKLIVDPWVTQPVNLD--NYTWEEVCRTSQPE-----SGLMS 1340

  Fly   862 SSTSVLSTISPQE 874
            :::..|::.||.|
  Rat  1341 AASLELASRSPSE 1353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 33/97 (34%)
PAS 74..169 CDD:238075 33/97 (34%)
PAS_9 286..>335 CDD:290162 17/55 (31%)
PAS 286..>325 CDD:238075 13/39 (33%)
STKc_PASK 575..828 CDD:270906 140/253 (55%)
S_TKc 576..828 CDD:214567 140/252 (56%)
PaskNP_001009362.1 PAS_9 129..228 CDD:290162 35/101 (35%)
PAS 129..228 CDD:238075 35/101 (35%)
PAS_9 343..>386 CDD:290162 15/49 (31%)
STKc_PASK 1061..1314 CDD:270906
S_TKc 1062..1314 CDD:214567


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337036720
eggNOG 1 0.900 E2759_KOG1152
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 504 1.000 Inparanoid score I1264
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153824at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1087078
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 LDO PTHR24346
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
109.760

Return to query results.
Submit another query.