DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and par-1

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_995894.2 Gene:par-1 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster

Alignment Length:623 Identity:155/624 (25%)
Similarity:257/624 (41%) Gaps:144/624 (23%)


  Fly   329 KDSREEKSPNVSNTSITSNDWEPDTDPLVVDNDSSLQSCKKSSTNRTAPNNEQSSVGDAHLSCNL 393
            :..::::..:.:|.:|.|  ..|.|.|  |.|.:::.....||.:.|:                 
  Fly    72 QQQQQQQQHDSANANIVS--LPPTTTP--VANTNTMMPIVTSSNSATS----------------- 115

  Fly   394 ENSSGLFCDLRQPDDCTIDDILTPVNASNSFPADEFEVGSQSQ----VNESSLDK---------- 444
             ||:.                .||..||.:  |....|||.||    |:.|:.:.          
  Fly   116 -NSTA----------------ATPTPASGA--AATGGVGSVSQGPATVSASAANTNHSHQHSHQH 161

  Fly   445 ----AKSASTETCDASGSNPATRLLSSINGSFVGEAIHADGSVIEVVYSVLLQILPCSNRVYCIW 505
                |.:.:|:....|.:|.|....|:||    ....|..||          .:.|..|:     
  Fly   162 HHHVANNMTTDGARLSSNNSAVVASSAIN----HHHHHTPGS----------GVAPTVNK----- 207

  Fly   506 VCRNPSTRLDGEKYNYANLTSTFNSMASTVEQSLGQVIKTTAAQNSSRPN----SLSLVSKYEDE 566
                             |:.||.::..|.::|      :|::|:.|  ||    |.:.:.....|
  Fly   208 -----------------NVLSTHSAHPSAIKQ------RTSSAKGS--PNMQMRSSAPMRWRATE 247

  Fly   567 LYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIH 631
            .::|.|.    .|:.||:|.:..|.:|........|..|.|.|.:|      .....:::..|:.
  Fly   248 EHIGKYK----LIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQL------NPGSLQKLFREVR 302

  Fly   632 LLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYL 696
            :::.|:|.|||.:..|.|.:....|:|| :.||.:::.::.....|.||.....|||:..||.|.
  Fly   303 IMKMLDHPNIVKLFQVIETEKTLYLIME-YASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYC 366

  Fly   697 HEQKILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPEL 761
            |:::|:|||:|.||:::|....||:.|||.:.....|....||.|:..|.:||:..|.:|.|||:
  Fly   367 HQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGPEV 431

  Fly   762 EIWALGVTLYVLMFFENPFIDV------EETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMH 820
            ::|:|||.||.|:....||...      |..|:.:.:||..:|.....||...|..:|..|.::.
  Fly   432 DVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLE 496

  Fly   821 QLITDPWLT-----QEVNPSTFSFSWIVPCKAHEANPN----LYFSGYLYSSTSV-LSTISPQES 875
            .::.|.|:.     .|:.|      :|.| ||..|:|.    |...||..|.... ||.:...:.
  Fly   497 TIMGDKWMNMGFEEDELKP------YIEP-KADLADPKRIEALVAMGYNRSEIEASLSQVRYDDV 554

  Fly   876 FSHI----EESSIGGSDDARLASHRTGHKLCVNEAKHN 909
            |:..    .:|:...||.:|..|..:...:..|:|..|
  Fly   555 FATYLLLGRKSTDPESDGSRSGSSLSLRNISGNDAGAN 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162 0/6 (0%)
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 80/259 (31%)
S_TKc 576..828 CDD:214567 80/258 (31%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 81/263 (31%)
S_TKc 253..504 CDD:214567 81/262 (31%)
UBA_MARK_Par1 525..563 CDD:270522 8/38 (21%)
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24346
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.