DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and Pask

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_543126.2 Gene:Pask MGIID:2155936 Length:1383 Species:Mus musculus

Alignment Length:1311 Identity:339/1312 (26%)
Similarity:496/1312 (38%) Gaps:493/1312 (38%)


  Fly     6 DVTDQAAGKLSSSNAQCSRNRCANDDPIMGSHSQSRQNSSGMLNMMDASSFSMPPPNLHSSKVIN 70
            :..|..||.|.|::. ||..|                   |:.:....|..|.|        |.|
Mouse    91 EYADPTAGPLGSTSC-CSLLR-------------------GLASGCSGSLLSTP--------VCN 127

  Fly    71 PNKAIFTIDANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRV 135
            ||||:||:||.|.:|.:.|:|||.||||:|.:|..:.............:.:|:|..:|.| |..
Mouse   128 PNKAVFTVDAKTTEILVANDKACSLLGYSSHDLIGQKLAQFFLKSDSEVVEALSEEHVEAD-GHA 191

  Fly   136 VLLSGKVIEMKTKSGGKILVSLWIRQISSDGR--HIAVAEPVERHICHISTDRSGVITSVDSTTA 198
            .::.|.|:::.::.|.||.||:||:::..|..  .:.|.|||||....::....|.|||.||..|
Mouse   192 AVVFGTVVDIVSRIGEKIPVSVWIKRLQQDRGLCCVVVLEPVERVSAWVAFQSDGTITSCDSLFA 256

  Fly   199 TIFFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKFPLCLLI------- 256
            .:..:.|.:.|||..::.|||.::|| |..:.|||||:.||:.||..|...|||.|.:       
Mouse   257 HLHGFTSPKDVVGQCVIDLIPSMQLP-PPGQHIPKSLKIQRSVGRARDGTTFPLSLKLKSKPSGR 320

  Fly   257 -ALDEDASAGYSHSGKTGLNITVWVFQNLSGLIVVDDIGNILMCNQPFSLLMFGYGQDKIMNMHI 320
             ..|.:|::      :.|...:||||..:||||.:...|.|...|..|:|::||||:.:::..:|
Mouse   321 AVADSEAAS------EPGYQASVWVFCTISGLITLLPDGTIYGVNHSFALMLFGYGKTELLGKNI 379

  Fly   321 SAILPNF---------------------------------------------------------- 327
            :.::|.|                                                          
Mouse   380 TFLIPGFYHYMDLTYDSSVQLPDLVNCLDIGRKSGPGEMNSDAQHNWELASGAQGPRIDVVLARD 444

  Fly   328 ----------------------------------------GKDSREEK----------------- 335
                                                    |.||..|.                 
Mouse   445 HMPSQDETLKLVGGQVSSRTQTRLETGYKILPSSACQPSLGVDSNPEDGEQSLLTDQQSIPKRNL 509

  Fly   336 ---------------------------SPNVSNTS-ITSNDW----------------------- 349
                                       ..|:|..| :|...|                       
Mouse   510 PAHGGQNQLDTSEISLPVLKEHLLSEIQKNISEESPLTHRKWLSKVQQNPTKGSLPIHEEQLLFA 574

  Fly   350 ----------EP----------------------------DTDPL--VVDNDSSLQSCK------ 368
                      :|                            |::||  |.|..||:.:|.      
Mouse   575 GQHIHVLGKEDPSAAESYRESLLEESKSKPVDAKLFASCEDSEPLVSVKDRGSSVDTCNLHQEAQ 639

  Fly   369 -----KSSTN----RTAP---------------------------NNEQSSVGDAHLSCNL---- 393
                 .||.|    .|.|                           ..:.|:...:.::|.|    
Mouse   640 LELMGVSSPNPWADATMPEPHTTGQIAGGSLTYCPQYRSEWASQQRGQDSAPSPSGMACVLLGTP 704

  Fly   394 ------------------------------ENSSGL------------------FCDL------- 403
                                          |.:.|:                  ||||       
Mouse   705 TLDEPWPGVRNDREELQTCLIKEQLSKSSCEGNLGISRVELVPEEHPPFTAPVSFCDLGGRDLHA 769

  Fly   404 -----------------------------------------------RQPDDCT----------- 410
                                                           |.|..|:           
Mouse   770 SRSGSSSACYALATDLPGVLEAVEAQEADVNSYSWNLKELFLKDQTDRTPSHCSCTTSELSEAPS 834

  Fly   411 ----------------IDDIL----------TPVNASNSFPADEFEVG-SQSQVNESSLDKAKSA 448
                            ..|||          |..:.|......|...| .:::::..||..::..
Mouse   835 LSVVGSDLDVGILHRQTSDILVDREMLLLTGTYFDLSEGQRFQEMGAGHDRAELSNISLVSSEHY 899

  Fly   449 STETCDASGSNP-------------------------------ATRLLSSI-NGSFVGEAIHADG 481
            .|...::.|.:|                               ||.|...| .|.:.|...|.||
Mouse   900 ETSDIESPGCDPPLPDPGPNDMCLSAEKPRPSAQITSTPVARGATSLQQEIQEGIYSGSCYHRDG 964

  Fly   482 SVIEVVYSVLLQILPCSNRVYCIWVC-------RNPSTRLDGEKYNYANLTSTFNSMASTVEQSL 539
            ..:.:.:.|....|..|..::|.|:.       |:.:||   .:...|:|.|:.:||......|.
Mouse   965 LQLSIQFEVKRVELQGSATLFCCWLVKDLFHSHRDSATR---TRLFLASLPSSTHSMPELSGSSF 1026

  Fly   540 GQVIKTTA-AQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVI 603
            |:|::... .:.|..|..|..::..|     |:|...|.:|..:|.||:|:|..|........|:
Mouse  1027 GEVLRAKPWFEESPTPAELEGLAACE-----GEYDYKYNTISPLGSGAFGFVWTAVEKECNKEVV 1086

  Fly   604 TKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLW 668
            .|||.|||:.....::......|.:||.:|..::|.||:.|||:|||..|:|||||||||||||:
Mouse  1087 VKFIKKEKVLEDCWIEDPKLGRVTLEIAILSKVDHANIIKVLDIFENQEFFQLVMEKHGSGMDLF 1151

  Fly   669 TFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSATFMEEG 733
            .||:..|.:||.|.|:||||:..||.|||.|.|:|||||||||:|.::|||||||||||.::|.|
Mouse  1152 AFIDHHPCLDEPLASFIFRQLVSAVGYLHSQGIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERG 1216

  Fly   734 KFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVS 798
            |.|.||.||.|||:||||.||.|.|||||:|:||||||.|:|.||||.:||||::|.|..|..||
Mouse  1217 KLFYTFCGTIEYCAPEVLIGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEAVIHPPFLVS 1281

  Fly   799 EQLSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEANPNLYFSGYLYSS 863
            ::|..|||.:|...|:.|.|:.:||.|||:||.||.:  |::|...|:.::..     ||.|.::
Mouse  1282 QELMSLLSGLLQPCPEQRTTLEKLIRDPWVTQPVNLA--SYTWEEVCRTNQPE-----SGLLSAA 1339

  Fly   864 TSVLSTISPQE 874
            :..:.:.||.|
Mouse  1340 SLEIGSRSPSE 1350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 32/97 (33%)
PAS 74..169 CDD:238075 32/97 (33%)
PAS_9 286..>335 CDD:290162 19/147 (13%)
PAS 286..>325 CDD:238075 13/39 (33%)
STKc_PASK 575..828 CDD:270906 139/253 (55%)
S_TKc 576..828 CDD:214567 139/252 (55%)
PaskNP_543126.2 PAS 131..230 CDD:238075 33/99 (33%)
PAS 342..388 CDD:214512 14/46 (30%)
STKc_PASK 1058..1311 CDD:270906
S_TKc 1059..1311 CDD:214567


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337037207
eggNOG 1 0.900 E2759_KOG1152
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 495 1.000 Inparanoid score I1372
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1083519
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 LDO PTHR24346
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 1 0.960
109.780

Return to query results.
Submit another query.