DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and ppk6

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001342943.1 Gene:ppk6 PomBaseID:SPAC1805.01c Length:775 Species:Schizosaccharomyces pombe

Alignment Length:831 Identity:213/832 (26%)
Similarity:352/832 (42%) Gaps:206/832 (25%)


  Fly    30 DDPIMGSHSQSRQNSSGMLNMMDASSFSMPPPNLHS----SKVINPNK------------AIFTI 78
            ::|::|::..|.:.....||   .|.|::.|....|    |.|..|:|            ||.|.
pombe   100 NEPLVGNYYISTEALGDGLN---RSPFTINPEKRRSLSDISYVPIPHKEHSNWPVHCSSQAIVTT 161

  Fly    79 DANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSL-AEMQIEGDEGRVVLLSGKV 142
            ...|..|:..|:..|.|.||...:|.....||:......||:|:| ....|:.:..| :|..|.|
pombe   162 SNTTFSIWSANDYFCLLFGYAGSQLNRHSVFDIFPKSFSSHLSNLIVSFPIDNEHER-ILFCGDV 225

  Fly   143 IEMKTKSGGKILVSLWIRQISSDGRHIAVAEPVERHICHISTDRSGVITSVDSTTATIFFYESVE 207
            ..:.|..|.: |:..|:::  ..|:.|.:.|.||.....|.. :.||  :||..|.     :.:.
pombe   226 FPVITVDGVR-LMDFWVKE--KQGKLIWILEFVEESYIDIKL-QDGV--AVDERTE-----QPLT 279

  Fly   208 SVVGVSIVTLIPFIKLPDPDSREIPKSL-RKQRATGRTTDNVKFPLCLLIALDEDASAGYSHSGK 271
            |       .|:|        || :||:. ::...|.:||:....| .::..|.: :|..|.    
pombe   280 S-------DLLP--------SR-LPKTWDQRLYLTTKTTEGYYCP-SMIYPLSK-SSFQYI---- 322

  Fly   272 TGLNITVWVFQNLSGLIVVDDIGNILMCNQPFSLLMFGYGQDKIMNMHISAILPNFGKDSREEKS 336
                    :|...:||:.::....|:..|:.....|.||..  ::...||.|.|:|         
pombe   323 --------IFHYAAGLLFINSDFKIISLNEALFESMLGYSD--LLTKDISLIFPDF--------- 368

  Fly   337 PNVSNTSITSNDWEPDTDPLVVDNDSSLQSCKKSSTNRTAPNNEQSSVGDAHLSCNLENSSGLFC 401
                              .||:                       ..:.|:|             
pombe   369 ------------------KLVL-----------------------QQLADSH------------- 379

  Fly   402 DLRQPDDCTIDDILTPVNASNSFPADEFEVGSQSQVNES----SLDKAKSASTETCDASGSNPAT 462
                                   ..|...|.|:..|..:    :.||.|.|.             
pombe   380 -----------------------ALDPGRVVSEIHVRHAYRTCTADKMKKAD------------- 408

  Fly   463 RLLSSINGSFVGEAIHADGSVIEV---VYSVLLQILPCSNRVYCIWVCRNPSTRLDGEKYNYANL 524
                      ....||:||::|::   :.||....:..:...:.:|:..:          :..|.
pombe   409 ----------YPYLIHSDGNIIQIDCQIISVSPHSVKSNEPAFGVWLIFD----------SVDNR 453

  Fly   525 TSTF-NSMASTVEQSLGQVIKTTAAQNSSRPNSLSLVSKYED---ELYLGDYSKYYTSIRQIGRG 585
            .|.| .||.|:|  .|.:|:   .:..|.....||....|.|   |:...:.:. ||:|:::|.|
pombe   454 ASDFVRSMRSSV--ILEEVV---ISDESEEEEDLSADEDYVDSEWEVVPHNIAS-YTTIKELGIG 512

  Fly   586 AYGYVNMAFRNSDRL-LVITKFILKEKLCSQFMVKSRDCKEVPIEI---HLLQTLNHKNIVSVLD 646
            |||.|.:|...|::: .||.|.|.|.::.....::.:|...||:||   |.|:..:|.|||.::.
pombe   513 AYGQVKLATYKSNKVHEVILKSISKSRILLDSWMRDKDLGTVPMEISILHFLKAHSHPNIVKMIT 577

  Fly   647 VFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENI 711
            .||::..|.|:.|....|:||:.:||.:|.:.||....||.|:|.||.:||...|:||||||||:
pombe   578 FFEDNENYYLLTEPQKPGIDLFDYIELKPSISEKESKAIFFQIALAVAHLHSFDIIHRDIKDENV 642

  Fly   712 IIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFF 776
            |::.|...:||||||::..:.|. |.||.||..:.:||:|.|.:|:|.|.:|||||:.||.:::.
pombe   643 ILEGNGCARLIDFGSSSLTKNGP-FDTFRGTVGFAAPELLRGEKYLGKEQDIWALGILLYTIVYR 706

  Fly   777 ENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPW 827
            |||:.::||.|.|:::||..:|:....|:..||:::...|.|:.:.:...|
pombe   707 ENPYYNIEEILDAKLRIPFELSKDNVDLICRMLDRNVHDRITIEETLQHHW 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 27/96 (28%)
PAS 74..169 CDD:238075 27/96 (28%)
PAS_9 286..>335 CDD:290162 12/49 (24%)
PAS 286..>325 CDD:238075 10/39 (26%)
STKc_PASK 575..828 CDD:270906 101/258 (39%)
S_TKc 576..828 CDD:214567 101/257 (39%)
ppk6NP_001342943.1 STKc_PASK 502..758 CDD:270906 101/259 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I813
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1124928
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 LDO PTHR24346
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.