DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and ran1

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_595690.1 Gene:ran1 PomBaseID:SPBC19C2.05 Length:470 Species:Schizosaccharomyces pombe

Alignment Length:291 Identity:86/292 (29%)
Similarity:135/292 (46%) Gaps:46/292 (16%)


  Fly   569 LGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLL 633
            ||| |..:.||  ||.||||.|..|....|..|...|.:.|:.|..    |.:..:...:.:| .
pombe    14 LGD-SLRFVSI--IGAGAYGVVYKAEDIYDGTLYAVKALCKDGLNE----KQKKLQARELALH-A 70

  Fly   634 QTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLM--DEKLGSYIFRQVADAVNYL 696
            :..:|..|:::..|.|.:....:|::...:| ||:|:|..:.:.  :..|...:|.|:..||.:.
pombe    71 RVSSHPYIITLHRVLETEDAIYVVLQYCPNG-DLFTYITEKKVYQGNSHLIKTVFLQLISAVEHC 134

  Fly   697 HEQKILHRDIKDENIII--DQNFTIKLIDFGSATFMEEGKFF---STFYGTTEYCSPEV-----L 751
            |...|.|||:|.|||::  |.| |:.|.|||.||.......|   |.||.:.| |..||     |
pombe   135 HSVGIYHRDLKPENIMVGNDVN-TVYLADFGLATTEPYSSDFGCGSLFYMSPE-CQREVKKLSSL 197

  Fly   752 AGNRYVGPE-------------LEIWALGVTLYVLMFFENPF----IDVEETLKAEIQIPKA--- 796
            :....|.||             .::||||:.|..|....||:    ...:.|.::.:..|..   
pombe   198 SDMLPVTPEPIESQSSSFATAPNDVWALGIILINLCCKRNPWKRACSQTDGTYRSYVHNPSTLLS 262

  Fly   797 ---VSEQLSRLLSSMLNKDPKYRCTMHQLIT 824
               :|.:|:.||:.:.:::||.|.|:.:|.|
pombe   263 ILPISRELNSLLNRIFDRNPKTRITLPELST 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 82/286 (29%)
S_TKc 576..828 CDD:214567 82/285 (29%)
ran1NP_595690.1 STKc_Pat1_like 17..295 CDD:270895 83/288 (29%)
S_TKc 19..291 CDD:214567 80/282 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.