DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and PASK

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001239048.1 Gene:PASK HGNCID:17270 Length:1330 Species:Homo sapiens

Alignment Length:1219 Identity:335/1220 (27%)
Similarity:488/1220 (40%) Gaps:418/1220 (34%)


  Fly    15 LSSSNAQCSRNRC----ANDDPIMGSHSQS-----RQNSSGMLNMMDASSFSMPPPNLHSSKVIN 70
            |::.|...|:..|    .:.||.....|.|     |..|||.      ||..:|.|      |.|
Human    77 LAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGW------SSPLLPAP------VCN 129

  Fly    71 PNKAIFTIDANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRV 135
            |||||||:||.|.:|.:.|:|||.||||:||:|..:.............:.:|:|..:|.| |..
Human   130 PNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEAD-GHA 193

  Fly   136 VLLSGKVIEMKTKSGGKILVSLWIRQISSDGR--HIAVAEPVERHICHISTDRSGVITSVDSTTA 198
            .::.|.|:::.::||.||.||:|::::..:.|  .:.|.|||||....::....|.:||.||..|
Human   194 AVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFA 258

  Fly   199 TIFFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKFPLCLLI---ALDE 260
            .:..|.|.|.|.|..|..|||.::|| |..:.|||:|:.||:.||..|...|||.|.:   ...|
Human   259 HLHGYVSGEDVAGQHITDLIPSVQLP-PSGQHIPKNLKIQRSVGRARDGTTFPLSLKLKSQPSSE 322

  Fly   261 DASAGYSHSGKTGLNITVWVFQNLSGLIVVDDIGNILMCNQPFSLLMFGYGQDKIMNMHISAILP 325
            :|:.|.: :..:|...:||||..:||||.:...|.|...|..|:|.:||||:.:::..:|:.::|
Human   323 EATTGEA-APVSGYRASVWVFCTISGLITLLPDGTIHGINHSFALTLFGYGKTELLGKNITFLIP 386

  Fly   326 NF---------------------------------------------GKDSR------------- 332
            .|                                             |:|.|             
Human   387 GFYSYMDLAYNSSLQLPDLASCLDVGNESGCGERTLDPWQGQDPAEGGQDPRINVVLAGGHVVPR 451

  Fly   333 -------------------------------EEKSPNVSNT-----------------SITS--- 346
                                           .:.:|.|.|.                 .||:   
Human   452 DEIRKLMESQDIFTGTQTELIAGGQLLSCLSPQPAPGVDNVPEGSLPVHGEQALPKDQQITALGR 516

  Fly   347 ----------------------------------------------------------------- 346
                                                                             
Human   517 EEPVAIESPGQDLLGESRSEPVDVKPFASCEDSEAPVPAEDGGSDAGMCGLCQKAQLERMGVSGP 581

  Fly   347 ---------------------------------NDW----------------------EPDTDP- 355
                                             ::|                      .|..|. 
Human   582 SGSDLWAGAAVAKPQAKGQLAGGSLLMHCPCYGSEWGLWWRSQDLAPSPSGMAGLSFGTPTLDEP 646

  Fly   356 -LVVDND-SSLQSCK-KSSTNR----------------------TAPNN---------------- 379
             |.|:|| ..||:|. |...::                      |||.:                
Human   647 WLGVENDREELQTCLIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLGGRDLCGGCTGS 711

  Fly   380 ------------------EQSSVGDAHLSCNL----------ENSSGLFC---DLRQ-------- 405
                              |...|.....|.||          :.||...|   :||:        
Human   712 SSACYALATDLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETPSSLAVG 776

  Fly   406 --PD--------DCTIDD----ILT----PVNASNSF--------PADEFEVGSQSQVNESSLDK 444
              ||        .|.:||    :||    .:.....|        |.:..||...|..:.::.|:
Human   777 SDPDVGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASDR 841

  Fly   445 AK---------SASTETCDAS---------GSNP------ATRLLSSI-NGSFVGEAIHADGSVI 484
            ..         :...:||.::         .|.|      |..|...| .|::.|...|.||..:
Human   842 ESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYHRDGLRL 906

  Fly   485 EVVYSVLLQILPCSNRVYCIWVCRN---------PSTRLDGEKYNYANLT-STFNSMASTVEQSL 539
            .:.:.|....|.....::|.|:.::         ..|||     ..|:|. ||.::.|.....||
Human   907 SIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRL-----FLASLPGSTHSTAAELTGPSL 966

  Fly   540 GQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVIT 604
            .:|:: ........|.::.|......|   |:||:.|:::..:|.||:|:|..|........|:.
Human   967 VEVLR-ARPWFEEPPKAVELEGLAACE---GEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVV 1027

  Fly   605 KFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWT 669
            |||.|||:.....::.....:|.:||.:|..:.|.||:.|||:|||..|:||||||||||:||:.
Human  1028 KFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFA 1092

  Fly   670 FIERRPLMDEKLGSYIFRQV-------ADAVNYLHEQKILHRDIKDENIIIDQNFTIKLIDFGSA 727
            ||:|.|.:||.|.|||||||       ..||.||..:.|:|||||||||:|.::|||||||||||
Human  1093 FIDRHPRLDEPLASYIFRQVRAGQSRLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSA 1157

  Fly   728 TFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQ 792
            .::|.||.|.||.||.|||:||||.||.|.|||||:|:||||||.|:|.||||.::|||::|.|.
Human  1158 AYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIH 1222

  Fly   793 IPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSW 841
            .|..||::|..|:|.:|...|:.|.|:.:|:||||:||.||.:  .::|
Human  1223 PPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLA--DYTW 1269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 34/97 (35%)
PAS 74..169 CDD:238075 34/97 (35%)
PAS_9 286..>335 CDD:290162 18/138 (13%)
PAS 286..>325 CDD:238075 13/39 (33%)
STKc_PASK 575..828 CDD:270906 136/260 (52%)
S_TKc 576..828 CDD:214567 136/259 (53%)
PASKNP_001239048.1 PAS_9 133..232 CDD:290162 35/100 (35%)
PAS 133..232 CDD:238075 35/100 (35%)
PAS 344..401 CDD:214512 16/57 (28%)
PAS_9 347..>386 CDD:290162 13/39 (33%)
STKc_PASK 998..1258 CDD:270906 136/260 (52%)
S_TKc 999..1258 CDD:214567 136/259 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337036863
eggNOG 1 0.900 E2759_KOG1152
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 475 1.000 Inparanoid score I1479
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153824at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1073435
orthoMCL 1 0.900 OOG5_131169
Panther 1 1.100 LDO PTHR24346
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.