DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and Pim2

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_613072.1 Gene:Pim2 MGIID:97587 Length:370 Species:Mus musculus

Alignment Length:271 Identity:86/272 (32%)
Similarity:137/272 (50%) Gaps:17/272 (6%)


  Fly   563 YEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVP 627
            :|.|..||..         :|:|.:|.|....|.:||..|..|.|.:.::.....|.  |....|
Mouse    87 FEAEYRLGPL---------LGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWSTVS--DSVTCP 140

  Fly   628 IEIHLLQTL----NHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQ 688
            :|:.||..:    .|..::.:||.||....:.||:|:.....||:.:|..:..:.|......|.|
Mouse   141 LEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPMPAQDLFDYITEKGPLGESCSRSFFTQ 205

  Fly   689 VADAVNYLHEQKILHRDIKDENIIIDQ-NFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLA 752
            |..||.:.|.:.::|||||||||:||. ..:||||||||...:.: :.::.|.||..|..||.::
Mouse   206 VVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHD-EPYTDFDGTRVYSPPEWIS 269

  Fly   753 GNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRC 817
            .::|......:|:|||.||.::..:.||...:|.|:||:..|..||.....|:...|...|..|.
Mouse   270 RHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRP 334

  Fly   818 TMHQLITDPWL 828
            ::.:::.|||:
Mouse   335 SLEEILLDPWM 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 82/258 (32%)
S_TKc 576..828 CDD:214567 82/257 (32%)
Pim2NP_613072.1 PKc_like 90..346 CDD:304357 85/269 (32%)
S_TKc 91..345 CDD:214567 84/266 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.