DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and kin-33

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001023760.2 Gene:kin-33 WormBaseID:WBGene00017083 Length:337 Species:Caenorhabditis elegans

Alignment Length:276 Identity:70/277 (25%)
Similarity:127/277 (46%) Gaps:37/277 (13%)


  Fly   576 YTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKE-----VPIEIHLLQT 635
            |..:..:|:|.:|.|         ||:..:.:..|.:..:.:..|.:..|     |..|..|.:.
 Worm    18 YQVLGLLGKGTFGKV---------LLIELESLPGEAVAMKEIEASGEHVEQITLNVKKEYILTKR 73

  Fly   636 LN---HKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLH 697
            |:   |:|::..|.:......|.|:|| :..|.||:..|.....:........|:|:...:.|:|
 Worm    74 LSAPGHENVIRFLSIRTMPEHYFLIME-YADGGDLFDKISSEYRLTSSQAHGYFKQLIAGLRYIH 137

  Fly   698 EQKILHRDIKDENIIIDQNFTIKLIDFGSAT---FMEEGKFFSTFYGTTEYCSPEVLAGNRYVGP 759
            .:.:.|||||.||:::.:...:|:.|||..|   ...|.....|..||.:|.:||||.||:|.||
 Worm   138 SKGVTHRDIKPENLMLTKAGVLKITDFGLGTLHIIKGEESLMDTRCGTPQYAAPEVLVGNQYRGP 202

  Fly   760 ELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSR-------------LLSSMLNK 811
            .::||:.||.|..::...:|:   ::..|::....:..:::.:.             ||.|:|..
 Worm   203 PVDIWSAGVVLINMLTGHSPW---KKACKSDASYTRWFNDECTERDAWSDLGARVITLLCSILAH 264

  Fly   812 DPKYRCTMHQLITDPW 827
            :|.:|..:..:..|.|
 Worm   265 NPTHRAPIELIEQDHW 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 70/277 (25%)
S_TKc 576..828 CDD:214567 70/277 (25%)
kin-33NP_001023760.2 PKc_like 16..281 CDD:304357 70/277 (25%)
S_TKc 18..281 CDD:214567 70/277 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.