DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and prk-1

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001263706.1 Gene:prk-1 WormBaseID:WBGene00004182 Length:589 Species:Caenorhabditis elegans

Alignment Length:469 Identity:109/470 (23%)
Similarity:199/470 (42%) Gaps:75/470 (16%)


  Fly   563 YEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSD-RLLVITKFILKEKLCSQFMVKSRDCKE- 625
            :|.:..:.::.:.|..:.:||||.:|.|..|....| :..|..||:..:.:.|..|.    |:: 
 Worm    44 HEKKHSVKEFKRKYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSWTMT----CRQL 104

  Fly   626 VPIEIHLLQTLNH-KNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQV 689
            :|.|:..|:|... ..::.:||.|.|...:.:|||:..:.|||:..:.....::|.:|.:||:||
 Worm   105 IPSEVCHLETCEDIPGVIKILDWFANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQV 169

  Fly   690 ADAV-NYLHEQKILHRDIKDENIIIDQNF-TIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLA 752
            ...| |...:..:|||||||||:|::.|. .:||:|||:..:.|:.. ...|.||..||.||...
 Worm   170 ITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKAT-KKEFQGTRSYCPPEWFR 233

  Fly   753 GNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRC 817
            ...|:..|...|:|||.|::|:..:.||.:..:.....::.|..:|:::.:|:.|.|......|.
 Worm   234 DQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARA 298

  Fly   818 TMHQLITDPWLTQEV----NPSTFSFSW-------------------------IVPCKAHEANPN 853
            ::.|:...||:..:.    ...||..:.                         ::..::.|:..:
 Worm   299 SLAQIAAHPWMETDKPFFGGDLTFEEALMEIKNPPVVIEDKEAEEEDNDLNDVVILTRSRESRTD 363

  Fly   854 LYFSGYLYSSTSVLSTISPQESFSHIEESSIGGSDDARLASHRTGH--KLCVNEAKHNK------ 910
            |.........|:|.....|..:...:|:..|          ..||.  .|..:|::::.      
 Worm   364 LDAESICTMVTAVEDRYEPSIAVKELEQEEI----------VETGETTNLMRSESRYDNISSSSF 418

  Fly   911 ------MDTLYAKQFQLNTSVSNHELRVSLPDSSHTEIGGSICSSKSENDIFKNKLQPCVSTYNV 969
                  :.:.|..||...:.:......|.....|.:.:..|:.:.||            .|.||:
 Worm   419 CDYVSLVSSSYDDQFTSTSDIYQSACEVFPHTGSSSSLSRSMGAVKS------------ASAYNL 471

  Fly   970 VSLHDVSTKPKKLD 983
            |.:...|:..|..|
 Worm   472 VRMRKKSSIFKSFD 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 80/258 (31%)
S_TKc 576..828 CDD:214567 80/257 (31%)
prk-1NP_001263706.1 STKc_PIM 56..309 CDD:270907 80/258 (31%)
Pkinase 57..309 CDD:278497 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374912
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.