DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and prk-2

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_497696.2 Gene:prk-2 WormBaseID:WBGene00004183 Length:441 Species:Caenorhabditis elegans

Alignment Length:407 Identity:115/408 (28%)
Similarity:186/408 (46%) Gaps:51/408 (13%)


  Fly   556 SLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKS 620
            :|.|:...|.......:.|.|....::|||.:|.|..|.|..|..||..|||.:..:.....:..
 Worm    11 NLKLLLNGESSRGFSKFKKNYKLKAELGRGGFGVVYRAVRTCDNALVAVKFIERSNVKEWARING 75

  Fly   621 RDCKEVPIEIHLLQTLNH-KNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSY 684
               ::||:||.:|...:. :.::.:||.:.....:.:|||:....:|::.||:.:..:.|.:..:
 Worm    76 ---EQVPMEICMLAKCSKVRGVIRLLDWYSIPEGFLIVMERPYPCIDMFDFIKGQGKISEDMARF 137

  Fly   685 IFRQVADAVNYLHEQKILHRDIKDENIIID-QNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSP 748
            :|||:|..|:...:.::||||:|||||:|| ...:.||||||:||.:...: :|.|.||..||.|
 Worm   138 LFRQIAVTVHECVQNRVLHRDLKDENIVIDLVTGSTKLIDFGAATVLRRSQ-YSDFQGTRLYCPP 201

  Fly   749 EVLAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIP----KAVSEQLSRLLSSML 809
            |....:.|:|.|..:|:|||.||..:....||.:.::...|.:..|    ..||.::..|:|..|
 Worm   202 EWFLHSLYLGREAAVWSLGVLLYNSLNGRLPFRNEKDICTAHLLGPLPFFVPVSAEVKDLISKCL 266

  Fly   810 NKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEANPNLYFSGYLYSSTSVLSTISPQE 874
            ..||..||::..::..||:.|:      :.||....|..........|...:|.|  |...|..|
 Worm   267 TFDPFQRCSLEAILNHPWVKQQ------TLSWDALTKNKVQKKTSESSDDHHSET--LGDHSETE 323

  Fly   875 SFSHIEESSIG---GSDDARL---ASHRTGHKLCVNEAKHNKMDTLYAK---------------- 917
            .......||:.   ||.|..:   ||....|    |:.|.|..:...||                
 Worm   324 EDRSPPTSSVSQQPGSADEGVGLSASSSNTH----NQKKPNHKEFRMAKTSLLAPPTSIEMKAAV 384

  Fly   918 -------QFQLNTSVSN 927
                   ||.::|::.|
 Worm   385 QASKTPTQFNVHTALKN 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 84/259 (32%)
S_TKc 576..828 CDD:214567 84/258 (33%)
prk-2NP_497696.2 STKc_PIM 30..285 CDD:270907 84/259 (32%)
Pkinase 31..285 CDD:278497 84/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374912
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2244
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.