DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and pim3

DIOPT Version :9

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:XP_002932230.2 Gene:pim3 / 100497723 XenbaseID:XB-GENE-922022 Length:323 Species:Xenopus tropicalis


Alignment Length:313 Identity:91/313 - (29%)
Similarity:154/313 - (49%) Gaps:31/313 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 LTSTFNSMA-----STVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIG 583
            |.|.|.|:|     |.:|....::::..               |.|.|    .:.|.|.....:|
 Frog     2 LLSKFGSLAHICNPSNMEHLPVKILQPV---------------KVEKE----PFEKVYQVGSVLG 47

  Fly   584 RGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTL--NHKNIVSVLD 646
            .|.:|.|....|.:|.|.|..|.:.||::.....:..   ..||:||.||:.:  ..:.::.:||
 Frog    48 SGGFGTVYSGSRIADGLPVAVKHVAKERVTDWGTLNG---VMVPLEIVLLKKVGTGFRGVIKLLD 109

  Fly   647 VFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENI 711
            .:|....:.:|||:.....||:.:|..:..:||......||||.:||.:.:...::||||||||:
 Frog   110 WYERADGFLIVMERPEPVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENL 174

  Fly   712 IID-QNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMF 775
            ::| :|..:|||||||...::: ..::.|.||..|..||.:..:||.|....:|:|||.||.::.
 Frog   175 LVDLRNGELKLIDFGSGALLKD-TVYTDFDGTRVYSPPEWVRYHRYHGRSATVWSLGVLLYDMVC 238

  Fly   776 FENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWL 828
            .:.||...||.::..:...:.:|.:..:|:...|:..|..|.|:.|:...||:
 Frog   239 GDIPFEQDEEIVRVRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFDHPWM 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 79/255 (31%)
S_TKc 576..828 CDD:214567 79/254 (31%)
pim3XP_002932230.2 STKc_PIM3 39..291 CDD:271004 79/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.