DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pask and pask

Sequence 1:NP_611864.1 Gene:Pask FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:XP_004917848.1 Gene:pask XenbaseID:XB-GENE-950862 Length:1189 Species:Xenopus tropicalis

Alignment Length:1196 Identity:315/1197 (26%)
Similarity:492/1197 (41%) Gaps:390/1197 (33%)


  Fly    15 LSSSNAQ--CSRNRCANDDPIMGSHSQSRQNSSGMLNMMDASSFSMPPPNLH------------- 64
            ||.|..|  |.|.|      ..|...:||.|::. |...|.||:|:.....|             
 Frog    20 LSKSFPQIPCPRQR------RHGGREKSRWNTAS-LTGEDWSSYSLSAATSHILLRSNHESNGIP 77

  Fly    65 --------SSKVINPNKAIFTIDANTGQIFIVNNKACQLLGYTSQELRNKGFFDLLNGKTESH-I 120
                    .|...:.|:|:.|:...|.:|.:.|:|||:|..|:|.||.......|:  ...|| :
 Frog    78 MDDTNQSLPSCARSSNRAVLTVSTKTSKILMANDKACRLFEYSSPELIGMSLSQLI--PASSHRV 140

  Fly   121 SSLAEMQIEGDEG--RVVLLSGKVIEMKTKSGGKILVSLWIRQISSDGRHIAVAEPVERHICHIS 183
            |...|.::...:|  ||   .|:|:|...:.|..|.:.:|||:|.:  :.:.:.|.|::....:|
 Frog   141 SEALEDELTESDGFSRV---PGEVVEAVRRGGETITLCMWIRRIQN--QCLLLLETVQQITATVS 200

  Fly   184 TDRSGVITSVDSTTATIFFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNV 248
            ..:.|.|.|.|.|.|.::.|...|.|:|..|..|:|.:.:| ...||||::||.||..|.|.|..
 Frog   201 FRQDGRILSCDPTCARLYGYMEPEEVLGQHITDLLPTVNIP-LQGREIPQNLRCQRLVGVTRDGA 264

  Fly   249 KFPLCLLIALDEDASAGYSHSGKTGLNI-----TVWVFQNLSGLIVVDDIGNILMCNQPFSLLMF 308
            .|||.|.::   :||.      .||.::     ::.:..:::|||.:...|:|...|..||..:|
 Frog   265 NFPLSLNLS---EASV------DTGSHVEEYCASLSILSSINGLITLRPDGSIRGLNGSFSNSLF 320

  Fly   309 GYGQDKIMNMHISAILPNF---GKDSREEKSP-----------NVSNTSITSN-----DWEPDT- 353
            ||.:.:::..:|:.::|.|   .:.:.:|.||           :.|:..|:||     ..|.|| 
 Frog   321 GYDRTQLLGKNITFLIPGFYHYMRSAGDEPSPLLTPLGETLDTSGSSDMISSNATKEKSSEHDTF 385

  Fly   354 -DPLVVDNDSSLQSCKKSSTNRT----APNNEQSSVGDA-------------------------- 387
             :||...|.....:|....|::|    |.||::.:|..|                          
 Frog   386 HNPLSDGNWLQAPACCILQTSQTPLTRAVNNQEMAVSSAPENDYLQSVPTCCVSPGTPTQDEPWE 450

  Fly   388 ---HLSCNLENSSGL--------------------------------------FCDLRQPDDCTI 411
               :...:|:..||:                                      |..:..|....:
 Frog   451 REKYTRHDLDLESGITPLTHCLRTLSLSKSQSEKKEAHQHINSHQVFPTVEKAFSPVLSPCPSAV 515

  Fly   412 DDILTPVNASNSFPADEFEV----GSQS------------------------------QVNESSL 442
            .:|..|.||....|....:|    ||.|                              .:||::.
 Frog   516 GEIHQPPNALGVSPPITVQVTRLPGSPSFLSETTSIPLRNVCSNAHHHGTLLQAEITHNMNETNA 580

  Fly   443 DKA----------------------KSASTETCDASGSN-------------------------- 459
            .::                      |:||....:.:|:|                          
 Frog   581 ARSTPSANNIPVISSPPLCHHNPVIKTASVIHANNAGANNTPSSTLHNNLSLSPVSTVSFSEYIM 645

  Fly   460 ----------------------PATRLLSSI---------------------------------- 468
                                  |.:.:||.:                                  
 Frog   646 QSTANTSCSPDKIPTIVDADSCPTSSVLSPLPTELSTENKDSESLVGGVFLYNRNSPTPNLSPCR 710

  Fly   469 ----------------------------------------------------------------- 468
                                                                             
 Frog   711 SVEPDAVNRLSREESSPIPPSQEGESNRYSSETLSQVTSTPVKDDSPHSLQLESADLSHKELQVP 775

  Fly   469 -------NGSFVGEAIHADGSVIEVVYSVLLQILPCSNRVYCIWVCRN---------PSTRLDGE 517
                   .|.|.|...|.|||.:.:.:.| .:.:...:.::.:||.::         ..|||   
 Frog   776 FAGGEIREGIFNGSCYHRDGSRLFIQFDV-QRTVSAGSYLFNVWVSKDLLQSQRDAIARTRL--- 836

  Fly   518 KYNYANLTSTFNSMASTV----EQSLGQVIKTTA-AQNSSRPNSLSLVSKYEDELYLGDYSKYYT 577
                  |.|:|.|.:.::    |:|||::|:.:| |...:....|.:|....     |.|:..|.
 Frog   837 ------LLSSFASSSQSLLEQSERSLGELIRNSANAGYCTELQDLQIVGACN-----GQYALKYQ 890

  Fly   578 SIRQIGRGAYGYV-NMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNI 641
            ::..:|:||:|:| :...|:|.:..|:.|||.|:::.....|:..:..:|..||.:|..:.|.||
 Frog   891 TVSPLGKGAFGFVWSACGRDSAKEEVVVKFIRKDRVLDDCWVQDPELGKVTQEIAILSRVQHPNI 955

  Fly   642 VSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDI 706
            :.|:||||||.|:|||||.||.|:||:.||:.:|.:||.|.||||||:..||.|||.|.||||||
 Frog   956 IRVVDVFENDTFFQLVMELHGDGLDLFDFIDSQPSLDEPLASYIFRQLVSAVGYLHNQHILHRDI 1020

  Fly   707 KDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLY 771
            |||||||..:|:|||:|||||..:.:|..||||.||||||:||||.||.|.|||||:|:||||||
 Frog  1021 KDENIIIAPDFSIKLVDFGSAAHLHQGTLFSTFCGTTEYCAPEVLLGNPYPGPELEMWSLGVTLY 1085

  Fly   772 VLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPST 836
            .|:|.||||.:|:|.|:||:..|..||::|..|:|.:|.:||:.|.|:.:|:.|||:||.:|.:.
 Frog  1086 TLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPWVTQPINLAE 1150

  Fly   837 FSFSWIV-PCKAH--EANPNLYFSGY 859
            :::..:. |..:|  :..|.|....|
 Frog  1151 YTWEEVYPPASSHKDDDGPGLCPDSY 1176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162 30/98 (31%)
PAS 74..169 CDD:238075 30/98 (31%)
PAS_9 286..>335 CDD:290162 15/52 (29%)
PAS 286..>325 CDD:238075 12/39 (31%)
STKc_PASK 575..828 CDD:270906 135/254 (53%)
S_TKc 576..828 CDD:214567 135/253 (53%)
paskXP_004917848.1 PAS 105..195 CDD:238075 29/97 (30%)
PAS 204..290 CDD:238075 33/96 (34%)
PKc_like 888..1142 CDD:304357 135/254 (53%)
S_TKc 889..1142 CDD:214567 135/253 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D153824at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.