DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG6175

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001261708.1 Gene:CG6175 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster

Alignment Length:160 Identity:33/161 (20%)
Similarity:64/161 (40%) Gaps:38/161 (24%)


  Fly    24 WTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHDYG-------KKVHNL 81
            |:|..|...||.||....||:..::.|..|..:.:|       |::....||       .|:.:|
  Fly    56 WSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEA-------LKLLSQKYGTEIRSIRSKIKSL 113

  Fly    82 RNQFNAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMC 146
            |:.|:.|..|:     .||.:|.......|..::.:.|:             ..|::...:    
  Fly   114 RSSFHREHGKV-----LSGRNRGVIYQPMWFAYEAIRFI-------------LDGERDQDR---- 156

  Fly   147 YPDQDVEKQSQSSIESLESMIIENDAEICQ 176
              |||.::.:::..|..|.:.:.:..::.|
  Fly   157 --DQDQDQDAETETEVDEKLALMHSLDLEQ 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 23/101 (23%)
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.