DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG8281

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648161.1 Gene:CG8281 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster

Alignment Length:213 Identity:52/214 (24%)
Similarity:77/214 (36%) Gaps:47/214 (22%)


  Fly    26 REKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESIC-----ASLEITKHDYGKKVHNLRNQF 85
            |..:...|:.||....||:.....|.|::.||:|...:.     ...:.|..|..||::.||..:
  Fly    20 RHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNY 84

  Fly    86 NAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRS-----VIEP----RPGYQQGAPGKKLVS 141
            ..|||.:|..|.  .|...|.:.  |. |:.|.|||:     .:.|    .|.:..|....    
  Fly    85 RKELKVVESALR--SGSLHSPRC--WT-FQELDFLRNSEKFLAVNPAFKNEPNFAFGESSN---- 140

  Fly   142 KLDMCYPDQDVEKQSQSSIESLESMIIENDAEIC--QPPKVSEPIPP---MPPEPAPSSKFVDPN 201
                | |...:|.|..:         :...|...  |.|.:||....   .||.|.|::..||..
  Fly   141 ----C-PSAFLESQGAA---------LHYPAPRAGGQTPNISEMFHKSFGAPPPPPPATNHVDYG 191

  Fly   202 RTVEAPAAPSPFHLPLSG 219
            .:..|...|     |.:|
  Fly   192 SSKRARQTP-----PCTG 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 29/104 (28%)
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130767811
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.