DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10904 and CG3386

DIOPT Version :9

Sequence 1:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster


Alignment Length:200 Identity:44/200 - (22%)
Similarity:84/200 - (42%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KQTIWTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASL-EI----TKHDYGKKVH 79
            |:..| ||.:|    ||:....||:.:...|:||:.|.:|.|.:...| ||    |:.:.|::::
  Fly    13 KRQFW-REFLA----LYQGMPELWDVHHLNYRNKELRNRAYELLERKLREIQPNATRTEVGRRIN 72

  Fly    80 NLRNQFNAELKKLERRLEESGGDRDSEKACRWEH-FKTLMFLRSVIEPRPGYQQGAPGKKLVSKL 143
            ..|..:..|..::.:: :|.|...|..|...|.: :...:..:...:.|.  ::|..|::     
  Fly    73 IFRTNYRREQMRILKQ-KELGLHSDLCKPTLWFYDYMGFLLTQETFQHRT--RKGRGGRQ----- 129

  Fly   144 DMCYPDQDV--EKQSQSSIESLESMIIENDAEICQPP--------KVSEPIPPMPPEP---APSS 195
                 .||.  ||..:..:::.:.    |...:|..|        ..|||..|...|.   :|..
  Fly   130 -----KQDFRREKDDKYPLKNPDL----NTESVCDWPIKDDNAFNYQSEPTAPQSEEGSLLSPKL 185

  Fly   196 KFVDP 200
            :.::|
  Fly   186 EIIEP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 22/99 (22%)
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.