DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG33017

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001286483.1 Gene:CG33017 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster

Alignment Length:287 Identity:61/288 (21%)
Similarity:98/288 (34%) Gaps:83/288 (29%)


  Fly    27 EKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLE--ITKHDYGKKVHNLRNQFNAEL 89
            :|..|||.||||::||||..|..:.:...:..|...|...:.  :|......:|..||:.::.||
  Fly    16 KKTQKLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNCGLTPDQVELQVLGLRHYYSKEL 80

  Fly    90 KKLERRLEESG----------------GDRDSEKAC--RWEHF----------KTLMFL------ 120
            ..: |..:..|                |:.:.|..|  :..||          ..|.||      
  Fly    81 AAI-RNSQIEGYSYSPRYSYFEDLHFLGNLEEEANCPIKEGHFPPNFSEDTFISPLAFLSPSCSE 144

  Fly   121 --------RSVIEPRPGYQQ--GAPGKKLVSKLDMCYP-----------DQD----VEKQSQSSI 160
                    :.::||.|..::  |...::..|..|..||           |:|    .|.:.|||.
  Fly   145 TRCGYTFYKMILEPEPPNEEFLGVHHERSTSGNDRWYPTAYCVRCKPEEDEDPCEACELRGQSSR 209

  Fly   161 ESLES-MIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDPN-------RTVEAPAAPSPFHLPL 217
            ....| ..:|........|::|...    .|...|:||...:       :....|...:|.....
  Fly   210 PQFGSKSSLEGGESGSTNPRMSNRY----QEQDQSNKFQKSDSKQYRTGKPCSCPTKDNPEKRSS 270

  Fly   218 S--------GRDQWDAFGELIASEFRN 236
            .        |.|.||.: |.:.:..|:
  Fly   271 QTQQNDVYVGADNWDGY-ESVGNGIRS 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 30/138 (22%)
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130768689
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.