DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10904 and CG33017

DIOPT Version :10

Sequence 1:NP_611860.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_788375.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster


Alignment Length:287 Identity:61/287 - (21%)
Similarity:98/287 - (34%) Gaps:83/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLE--ITKHDYGKKVHNLRNQFNAEL 89
            :|..|||.||||::||||..|..:.:...:..|...|...:.  :|......:|..||:.::.||
  Fly    16 KKTQKLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNCGLTPDQVELQVLGLRHYYSKEL 80

  Fly    90 KKLERRLEESG----------------GDRDSEKAC--RWEHF----------KTLMFL------ 120
            ..: |..:..|                |:.:.|..|  :..||          ..|.||      
  Fly    81 AAI-RNSQIEGYSYSPRYSYFEDLHFLGNLEEEANCPIKEGHFPPNFSEDTFISPLAFLSPSCSE 144

  Fly   121 --------RSVIEPRPGYQQ--GAPGKKLVSKLDMCYP-----------DQD----VEKQSQSSI 160
                    :.::||.|..::  |...::..|..|..||           |:|    .|.:.|||.
  Fly   145 TRCGYTFYKMILEPEPPNEEFLGVHHERSTSGNDRWYPTAYCVRCKPEEDEDPCEACELRGQSSR 209

  Fly   161 ESLES-MIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDPN-------RTVEAPAAPSPFHLPL 217
            ....| ..:|........|::|...    .|...|:||...:       :....|...:|.....
  Fly   210 PQFGSKSSLEGGESGSTNPRMSNRY----QEQDQSNKFQKSDSKQYRTGKPCSCPTKDNPEKRSS 270

  Fly   218 S--------GRDQWDAFGELIASEFRN 236
            .        |.|.||.: |.:.:..|:
  Fly   271 QTQQNDVYVGADNWDGY-ESVGNGIRS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10904NP_611860.1 MADF 31..125 CDD:214738 30/137 (22%)
CG33017NP_788375.1 MADF_DNA_bdg 21..106 CDD:463144 21/85 (25%)
PTZ00108 <580..830 CDD:240271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.