DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG15601

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster

Alignment Length:269 Identity:71/270 (26%)
Similarity:107/270 (40%) Gaps:55/270 (20%)


  Fly    25 TREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEI---TKHDYGKKVHNLRNQFN 86
            |:..|.:.:|.||...||:|...:.|||:..|.:|..:|..||:|   |..|...|:.::|..::
  Fly     7 TKIPITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQLTVSDIKLKIKSVRTVYS 71

  Fly    87 AELKKLERRLEESGGDRDSEKACRWEHFKTL-MFLRSVIE---PRPGYQQGAPGKKLVSKLD--- 144
            .|| ::..|.:|.|  |..|....|  |:.. .|||||..   .|.|....:..:....|.|   
  Fly    72 KEL-RIWMREKELG--RTYEPKLFW--FRLADSFLRSVSLSHCKRQGKNNSSSAQLTTIKSDETS 131

  Fly   145 --MCYPDQDVEKQSQSSIESLESMIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDPNRTVEAP 207
              :|....|: ..|:.::|       |.|||:...|   |..|  ..|..|::.....:.|:...
  Fly   132 KLLCTAAADI-TMSEDALE-------EEDAEVNGEP---EECP--LEESRPTASICKDDSTLCLA 183

  Fly   208 AAPSPFH-------------------------LPLSGRDQWDAFGELIASEFRNLNSEVSRKRLK 247
            ..|...|                         |..:|.|....||:.|||:.|.:....||...|
  Fly   184 DQPQQEHYSQGCSSSQQLPHTMAQRKSKYITSLDSAGEDDLIIFGQSIASQLRTIPDSYSRSVAK 248

  Fly   248 RKIMQVMLE 256
            .:|.||:.|
  Fly   249 LRIQQVLFE 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 33/98 (34%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130767486
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.