DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG4004

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_727638.1 Gene:CG4004 FlyBaseID:FBgn0030418 Length:339 Species:Drosophila melanogaster

Alignment Length:201 Identity:50/202 (25%)
Similarity:79/202 (39%) Gaps:59/202 (29%)


  Fly    42 LWNHYSELYKNKDCRAKAIESICASLEITK--------HDYGKKVHNLRNQFNAELKKLERRLEE 98
            ||...|:||:::..:   :||....||:.:        |...:|::|.|..:..||    |::.:
  Fly     4 LWLVRSKLYRDRQLK---LESYSRLLELLRTTDSYANIHTLKRKINNFRTSYRREL----RKVLD 61

  Fly    99 SGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQ----GAPGKKLV---------SKLDMCYPDQ 150
            ||   ::.|...| :||.|.||   .|...|..|    .|..:.||         |...:.:..|
  Fly    62 SG---NTYKPTLW-YFKELDFL---YELETGELQLEGIVAADRDLVRNSKVLQNESNKTITFGAQ 119

  Fly   151 DVEKQ-SQSSIESLESMIIENDAEICQPPK------VSEPIP--------------PMPPEPAPS 194
            ..|:: |.|.|...|..:.||..|..|..:      :|:..|              .:.|||.|.
  Fly   120 LAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVGDGDVEPEPEPD 184

  Fly   195 SKFVDP 200
            :   ||
  Fly   185 N---DP 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 25/91 (27%)
CG4004NP_727638.1 MADF_DNA_bdg 1..79 CDD:287510 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130767964
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.