DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG30403

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_726108.3 Gene:CG30403 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster

Alignment Length:299 Identity:62/300 (21%)
Similarity:104/300 (35%) Gaps:102/300 (34%)


  Fly    27 EKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIES-ICASLE-----ITKHDYGKKVHNLRNQF 85
            |:..|.:|||....||||....|.:.:....:.|:| |.|.:|     :|......|:.|||..:
  Fly    19 ERTVKFVELYGREPCLWNKRPYLRRARSAAYRRIQSGINADIEPYESGLTIQGVKMKIKNLRTGY 83

  Fly    86 NAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPG-------------- 136
            :.||||                            :|::    ||||...|.              
  Fly    84 HQELKK----------------------------IRTI----PGYQPKTPWFAPLHGFLAEFLDT 116

  Fly   137 ----------KKLVSKL-----------------DMCYPDQDVEKQSQSSIESLESMIIENDAEI 174
                      |:|..:|                 |:..||:.::....|....|.:.:...:...
  Fly   117 NELETSIPQLKRLQIRLTRLKPIKIQTEIKPDPDDLSVPDRPLDATPSSLFTVLPAPMPVEEPPT 181

  Fly   175 CQP--PKVSEPIPPMPPEPAP-----------------SSKFVDPNRTVEAPAAPSPFHL--PLS 218
            ..|  ||:.:.|.|:.|:|||                 .|:.:.....|.|....:...|  .:.
  Fly   182 PPPSVPKIGDIISPVHPDPAPVPIAGNCPLSTACSISEKSEVLGLGLGVSAAGRTNGVGLGVEMR 246

  Fly   219 GRDQWDAFGELIASEFRNLNSEVSRKRLKRKIMQVMLEV 257
            |.|::..||..:|::.||:  .::...|.:..:|.||.:
  Fly   247 GEDEFTYFGLSVAAQIRNM--PLASAMLMQSKIQYMLSM 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 24/100 (24%)
CG30403NP_726108.3 GT1 24..103 CDD:304916 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.