DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10904 and CG5180

Sequence 1:NP_001286800.1 Gene:CG10904 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001138087.1 Gene:CG5180 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster

Alignment Length:226 Identity:46/227 (20%)
Similarity:85/227 (37%) Gaps:62/227 (27%)


  Fly    24 WTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHD-----YGKKVHNLRN 83
            ::|..:.:.||.|:..:|||......|.|...|.|:.:.:...|:..:.:     ..:|:::||:
  Fly     8 YSRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRS 72

  Fly    84 QFNAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMCYP 148
            .|..|.:|...:     ||    .|.|..::..|:|   :.:.:|  ::...|.|...:|.:.:.
  Fly    73 AFRREFRKTSTK-----GD----YATRLWYYDKLLF---IADHKP--KRHELGSKPKRELHISFD 123

  Fly   149 DQDVEKQSQSSIESLESMIIENDAEI--CQPPKVSEPIPPMPPE--------------------- 190
            |:             |||..|:|:..  .|...:...||..|.:                     
  Fly   124 DE-------------ESMEFEDDSHHTGTQSQHMESIIPTSPDDVEEVAATANNVVVSSQGATLS 175

  Fly   191 -----PAPSSKFV--DPNRTVEAPAAPSPFH 214
                 ||.....|  :.::..||.||.:..|
  Fly   176 TISVTPAECVTLVKSEEHQAAEAAAAAAQAH 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 23/99 (23%)
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130767888
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21505
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.