DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and DNL4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_014647.1 Gene:DNL4 SGDID:S000005531 Length:944 Species:Saccharomyces cerevisiae

Alignment Length:730 Identity:166/731 (23%)
Similarity:280/731 (38%) Gaps:151/731 (21%)


  Fly   102 ENYDPSADSYHPLKNAYWKDKKV----TPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSP 162
            :|:.||.|.....:..:.|..:|    |.....:|:|          |..:.:|||.........
Yeast    12 QNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSF----------KYYEIISNFVEMWRKTVG 66

  Fly   163 EDLVPSVYLSINQLAPAYEGLELGVAETTLMKAIC--------KATGRNLAHIKSQTQLTGDLGI 219
            .::.|::.|::    |..:.....:.:..|::.||        .||.:.|...|.:....|:|..
Yeast    67 NNIYPALVLAL----PYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSS 127

  Fly   220 VAEQSRVSQRMMFQPAPLNVRDVFRKLREIAK---LSGQSKMDLVYNM-FVACRSS----EARFF 276
            :..:....:|.......:.:.:|...|..::.   .||:....||.:. |:.|..:    |.::|
Yeast   128 LLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVELKYF 192

  Fly   277 IRSLIGKLRIGIAEQSLLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYD 341
            ...::....||..|..||...        |.|   |.....|..|..|.|:.|          ||
Yeast   193 FDIVLKNRVIGGQEHKLLNCW--------HPD---AQDYLSVISDLKVVTSKL----------YD 236

  Fly   342 IIIPAI-LKYDIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHR 405
               |.: ||.|...::      .|....|.||:.....:|...|........|.|.||||.|:|.
Yeast   237 ---PKVRLKDDDLSIK------VGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHY 292

  Fly   406 NEKGE-ISIFSRNSENNTAKYPDLIARST----ALLKGDVKSYIIDSEIVAWDVERKQILPF--- 462
            ...|| |..|||...:.|..|...::..|    ......||..::|.|:|.:|.:|:.||||   
Yeast   293 MNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLV 357

  Fly   463 -----QVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKF 522
                 :.||.....|||...:.:     :|||||:|||:|....|.:|::.|......::...:.
Yeast   358 KGSAKEALSFNSINNVDFHPLYM-----VFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEI 417

  Fly   523 ATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLV 587
            ..:.....::.:::.||.:|....||:::|..:  ::|.:|.|:.||:|:|.:||...|::|||:
Yeast   418 VRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN--SSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

  Fly   588 VIGGYKGKGRRTGTYGGFLLACYDTENEEYQ------------------------------SICK 622
            ||      ||.:|....|:|.....:.|||:                              |.|.
Yeast   481 VI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCS 539

  Fly   623 IGTGFTDE-----DLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQ--VWEVKCADLSLSP 680
            |..|.:.|     |.:|...:......:...|...:...: |..|.:|.:  |.|:|...|..:.
Yeast   540 IANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKI-PAEWIDPSESIVLEIKSRSLDNTE 603

  Fly   681 IHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNN------------ 733
            .:.....     ...:|......|||.||   ..||...:..:|:|: .||:|            
Yeast   604 TNMQKYA-----TNCTLYGGYCKRIRYDK---EWTDCYTLNDLYESR-TVKSNPSYQAERSQLGL 659

  Fly   734 -QKSSTQMEMEDEFY 747
             :|...::.:.|.|:
Yeast   660 IRKKRKRVLISDSFH 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 165/727 (23%)
DNA_ligase_A_N 126..292 CDD:282522 32/182 (18%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 64/231 (28%)
OBF_DNA_ligase_I 581..726 CDD:153438 38/182 (21%)
DNL4NP_014647.1 DNA_ligase_A_N 20..207 CDD:282522 35/201 (17%)
dnl1 84..717 CDD:273147 150/645 (23%)
Adenylation_DNA_ligase_IV 244..471 CDD:185713 67/240 (28%)
OBF_DNA_ligase_IV 474..635 CDD:153437 37/176 (21%)
BRCT 681..767 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.