DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and CDC9

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_010117.1 Gene:CDC9 SGDID:S000002323 Length:755 Species:Saccharomyces cerevisiae

Alignment Length:747 Identity:313/748 (42%)
Similarity:457/748 (61%) Gaps:45/748 (6%)


  Fly     2 QKSITSFF-KKKSDATDSPSPPKKVPKIDAKTEL-----PDEPHIKSESASPETKPKVEPMSVDS 60
            |.::..|| ..|:..|:....|||..|...:..:     .:|...|....:..|.....|.|:.|
Yeast    38 QATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGS 102

  Fly    61 E----EKTSPVKNVKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWKD 121
            .    ..::|...|...|::        ....:|         :||:...|.::.|...|     
Yeast   103 NFSSIPSSAPSSGVADSPQQ--------SQRLVG---------EVEDALSSNNNDHYSSN----- 145

  Fly   122 KKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYE-GLEL 185
               .||..:...|..||....||::|...|:||..:|..|.::|:|:.||.||:|.|.|| ||||
Yeast   146 ---IPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLEL 207

  Fly   186 GVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIA 250
            |:.|..|||.|.:..|::::.||.:.:..||||.:|..:|..|..||:|.||.|.:||:.||.||
Yeast   208 GLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIA 272

  Fly   251 KLSGQ----SKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLVKKNHIDDCK 311
            |..|:    .||.|:..|..||:..||:|.||||..|||||:||:::|.:|:..|:.  |.::.:
Yeast   273 KTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLL--HDENRE 335

  Fly   312 ASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPMLAQPTK 376
            .|...||..|.:......::.|:||.|||:|:|.:.|::.|..|.:.|.:.||:||:||||:|||
Yeast   336 DSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTK 400

  Fly   377 GVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTALLKGDVK 441
            .::||.:||.|...|.|:||||||||:|....|.:.|:|||.||.|.:||::............|
Yeast   401 AINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTK 465

  Fly   442 SYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERR 506
            :.|:|.|.||||.::.:|||||||||||||:|::.::||:||::.||:|..|...|:.|:|.|||
Yeast   466 NLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERR 530

  Fly   507 KLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLD-EEATYEIAKRSRNWL 570
            :.|.:..:.|.||:::||.:.||::||:|:||:||:..:|||||||.|: .|:.||.:|||||||
Yeast   531 EYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWL 595

  Fly   571 KLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTH 635
            |||||||..|||||||.|:|.|.|:|:||||||||||.||:.:..|:::.|||||||:||.||..
Yeast   596 KLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

  Fly   636 SEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFP 700
            .:.|...:....|:.:.:|.|.|||.||||..::||..||||||||::|  |....::|:|||||
Yeast   661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKA--GSATFDKGVSLRFP 723

  Fly   701 RFIRIRDDKNSENATDANQVAHMYQSQDQVKN 732
            ||:|||:||..|:||.::|:..:|::|..::|
Yeast   724 RFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 313/748 (42%)
DNA_ligase_A_N 126..292 CDD:282522 77/171 (45%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 112/219 (51%)
OBF_DNA_ligase_I 581..726 CDD:153438 76/145 (52%)
CDC9NP_010117.1 dnl1 215..748 CDD:273147 257/537 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332594234
eggNOG 1 0.900 E1_COG1793
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 560 1.000 Inparanoid score I158
Isobase 1 0.950 0 Normalized mean entropy S1058
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003190
OrthoInspector 1 1.000 T1136871
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2092
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.