DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and LIG6

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_176845.2 Gene:LIG6 AraportID:AT1G66730 Length:1396 Species:Arabidopsis thaliana

Alignment Length:796 Identity:267/797 (34%)
Similarity:439/797 (55%) Gaps:68/797 (9%)


  Fly     2 QKSITSFFKKKSDA----------TDSPSPPKKVPKIDAK---TELPDE--------PHIKSESA 45
            |.::..||.|..|.          |:..:..||:..|||.   .|:.|:        ..::..:|
plant   599 QPTLFKFFNKVLDGGSNSVSVGSETEECNTDKKMVHIDASEAYKEVTDQFIDIVNGSESLRDYAA 663

  Fly    46 S--PETKPKV---------EPMSVDSE---EKTSPVKNVKKEPK-------EVDDKTTDKKVTTI 89
            |  .|.|..:         :|..:..:   |:....|.: :.||       :.|.|.::.....:
plant   664 SIIDEAKGDISRALNIYYSKPREIPGDHAGERGLSSKTI-QYPKCSEACSSQEDKKASENSGHAV 727

  Fly    90 GLNSTAATKEDVE-NY-DPSADSYHPLKNAYWKDKKVTPYLALARTFQVIEETKGRLKMIDTLSN 152
            .:....:.:|.|: || ....:.|.|.::|.|::.:..||:.|.|||..:|..||::|.:..|.|
plant   728 NICVQTSAEESVDKNYVSLPPEKYQPKEHACWREGQPAPYIHLVRTFASVESEKGKIKAMSMLCN 792

  Fly   153 FFCSVMLVSPEDLVPSVYLSINQLAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDL 217
            .|.|:..:||||::|:|||..|::|..:|.:||.:..:.:..|:.:|.|.:.:.::......|||
plant   793 MFRSLFALSPEDVLPAVYLCTNKIAADHENIELNIGGSLISSALEEACGISRSTVRDMYNSLGDL 857

  Fly   218 GIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIAKLSG----QSKMDLVYNMFVACRSSEARFFIR 278
            |.||:..|.:|:::..|.||.|||||..||:|:..:|    :.|.:|:..:..:||..|.:|.:|
plant   858 GDVAQLCRQTQKLLVPPPPLLVRDVFSTLRKISVQTGTGSTRLKKNLIVKLMRSCREKEIKFLVR 922

  Fly   279 SLIGKLRIGIAEQSLLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDII 343
            :|...||||...:::|.||...:|..:..:|.........:::::...:..:..||...|:.|::
plant   923 TLARNLRIGAMLRTVLPALGRAIVMNSFWNDHNKELSESCFREKLEGVSAAVVEAYNILPSLDVV 987

  Fly   344 IPAILKYDIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEK 408
            :|:::..||:.......|.||:|::||||:..|||.|.|........|||:||||:|||||:...
plant   988 VPSLMDKDIEFSTSTLSMVPGIPIKPMLAKIAKGVQEFFNLSQEKAFTCEYKYDGQRAQIHKLLD 1052

  Fly   409 GEISIFSRNSENNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWD-VERKQILPFQVLSTRKRKN 472
            |.:.|||||.:..|:::|||:...........:::::|:|:||.| :...:::.||.||||:|.:
plant  1053 GTVCIFSRNGDETTSRFPDLVDVIKQFSCPAAETFMLDAEVVATDRINGNKLMSFQELSTRERGS 1117

  Fly   473 VD----IEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVE-GEWKFA--------- 523
            .|    .|.|||:|||::||::::||..|:...|.|||:.|.|.|.|.. |..::|         
plant  1118 KDALITTESIKVEVCVFVFDIMFVNGEQLLALPLRERRRRLKEVFPETRPGYLEYAKEITVGAEE 1182

  Fly   524 TALDTND-IDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLV 587
            .:|:.:| :..:..||||:.:.:|||:|||:||..|.|...|||.:|||:|:||:..:||:||||
plant  1183 ASLNNHDTLSRINAFLEEAFQSSCEGIMVKSLDVNAGYCPTKRSDSWLKVKRDYVDGLGDTLDLV 1247

  Fly   588 VIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAK-SYY 651
            .||.:.|.||:.|.|..||:||::.|.||:||:|::.:||:|.......||..:....|.| .||
plant  1248 PIGAWYGNGRKAGWYSPFLMACFNPETEEFQSVCRVMSGFSDAFYIEMKEFYSEDKILAKKPPYY 1312

  Fly   652 RYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATD 716
            |...:  ||.||....|||::.||.::||:|.|::|:|...||||:||||||....|:|.|..:.
plant  1313 RTGET--PDMWFSAEVVWEIRGADFTVSPVHSASLGLVHPSRGISVRFPRFISKVTDRNPEECST 1375

  Fly   717 ANQVAHMYQSQDQVKN 732
            |..:|.|:.:|.:..|
plant  1376 ATDIAEMFHAQTRKMN 1391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 267/797 (34%)
DNA_ligase_A_N 126..292 CDD:282522 62/170 (36%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 94/234 (40%)
OBF_DNA_ligase_I 581..726 CDD:153438 64/146 (44%)
LIG6NP_176845.2 SNM1A-1C-like_MBL-fold 42..204 CDD:293831
DRMBL 276..380 CDD:284854
PRK01109 766..1389 CDD:234900 234/625 (37%)
DNA_ligase_A_N 766..937 CDD:282522 62/171 (36%)
Adenylation_DNA_ligase_I_Euk 1002..1236 CDD:185710 94/234 (40%)
OBF_DNA_ligase_I 1241..1385 CDD:153438 64/146 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.