DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and AT1G49250

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_175351.1 Gene:AT1G49250 AraportID:AT1G49250 Length:657 Species:Arabidopsis thaliana

Alignment Length:713 Identity:311/714 (44%)
Similarity:437/714 (61%) Gaps:69/714 (10%)


  Fly    44 SASPETKPKVEPMSVDSEEKTSPVKNVKKEPKEVDDKT----TDKKVTTIGLNSTAATKEDVENY 104
            :||.:.|.|:|             :.|...|..|||||    :|.|                   
plant     3 NASAKKKRKLE-------------ETVDTPPTRVDDKTLVLISDSK------------------- 35

  Fly   105 DPSADSYHPLKNAYWKDKKVTPYLALARTFQVIEETK-GRLKMIDTLSNFFCSVMLVSPEDLVPS 168
            .|.:|....||:.....||              :.|: ||:.:...|.|...:|:..:|:||:|:
plant    36 KPKSDRVTKLKSKIGLLKK--------------KPTESGRIVITHILCNMLRTVIATTPDDLLPT 86

  Fly   169 VYLSINQLAPAYEGLELGVAE-TTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMF 232
            |||:.|::|||:||::||:.: :.::|||.:|.||..:|::.|....||||:||..||.||.|:|
plant    87 VYLAANEIAPAHEGIKLGMGKGSYIIKAISEAFGRTESHVEQQYTQLGDLGLVANGSRSSQTMIF 151

  Fly   233 QPAPLNVRDVFRKLREIAKLSGQ----SKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSL 293
            .|.||.|..|...||.|||.||:    .|.||:..:.||....|..:..|.|...||:|.:.|::
plant   152 MPKPLTVVKVADTLRLIAKESGKGSKDKKKDLMKALLVATTDCEPLYLTRLLQDNLRLGFSRQTV 216

  Fly   294 LTALAIGLV-KKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQE 357
            |.||....| .:.|      ||.|...|:.:.:...::|..:...|.||||:.|:|...:..|.:
plant   217 LAALGQAAVYNEEH------SKPPPNIKNPLDEAATIVKEVFSMLPVYDIIVGALLTSGVWNLPK 275

  Fly   358 RCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNT 422
            .|.:..|:|:|||||:.|..|..:.|:|.....|.|:|||||||||:..|.|.:.||||::|.||
plant   276 TCNLTLGVPVRPMLAKATTRVDLILEKFKDTVFTAEYKYDGERAQIYYMEDGTVEIFSRHAERNT 340

  Fly   423 AKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIF 487
            .||||:....:.|.|..|||:|:|.|:|.::.|:::|||.|  |||..|||::.:|||.|||:.|
plant   341 GKYPDVALVLSRLKKPTVKSFILDCEVVTFNREKEKILPLQ--STRAHKNVNVSDIKVGVCVFAF 403

  Fly   488 DLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVK 552
            |:||:||..|:.:||:.||:.|.:.|:|..|.::|||||.:|||.|:|:||:.||...|||||:|
plant   404 DILYLNGQLLIHENLNIRREKLHDSFEEDLGYFQFATALTSNDIGELQEFLKASIDIGCEGLMIK 468

  Fly   553 TLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEY 617
            :|...||||.||||.|||||||||:.|:|||:|||.|..:.|:|:|||.:|.:||||||.:.||:
plant   469 SLYSNATYEPAKRSNNWLKLKKDYMDNIGDSVDLVPIATFHGRGKRTGFFGAYLLACYDVDKEEF 533

  Fly   618 QSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIH 682
            ||||||||.|:|.:||..|..|...|.:..|.||:.|..|.||.|.||.:|||||.|||::||::
plant   534 QSICKIGTEFSDVELQDLSSSLCSKVIATPKQYYQVDNDLNPDVWLEPTEVWEVKAADLTVSPVY 598

  Fly   683 RAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQMEMEDE 745
            |.||||||.::||||||||.:|||.|||.|.||.::|:|.|||:|   |:||.|: |.:::|:
plant   599 REAIGIVDPDKGISLRFPRLVRIRKDKNPEEATTSDQIAEMYQAQ---KHNQPSN-QGKVDDD 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 311/712 (44%)
DNA_ligase_A_N 126..292 CDD:282522 65/172 (38%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 114/218 (52%)
OBF_DNA_ligase_I 581..726 CDD:153438 85/145 (59%)
AT1G49250NP_175351.1 PLN03113 2..657 CDD:215584 311/712 (44%)
DNA_ligase_A_N 57..216 CDD:282522 65/159 (41%)
Adenylation_DNA_ligase_I_Euk 276..492 CDD:185710 114/218 (52%)
OBF_DNA_ligase_I 497..642 CDD:153438 85/145 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 632 1.000 Inparanoid score I190
OMA 1 1.010
OrthoDB 1 1.010 D274264at2759
OrthoInspector 1 1.000 T125076
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 O PTHR45674
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.