DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and LIG1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_172293.2 Gene:LIG1 AraportID:AT1G08130 Length:790 Species:Arabidopsis thaliana

Alignment Length:743 Identity:344/744 (46%)
Similarity:475/744 (64%) Gaps:27/744 (4%)


  Fly    10 KKKSDATD--SPSPPKKVPKIDAKTELPDEPHIKSESASPETKPKVEPMSVDSEEKTSPVKNVKK 72
            |||:..|.  |.||.|:  ||....:......|.||...|:|:..:||:| ||....|...::.:
plant    68 KKKTPQTTNLSRSPNKR--KIGETQDANLGKTIVSEGTLPKTEDLLEPVS-DSANPRSDTSSIAE 129

  Fly    73 EPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWKDKKVTPYLALARTFQVI 137
                 |.||..||..|  |:.|...|..:.......:.:.|.|.:.|:..:..|:|.:|..|.:|
plant   130 -----DSKTGAKKAKT--LSKTDEMKSKIGLLKKKPNDFDPEKMSCWEKGERVPFLFVALAFDLI 187

  Fly   138 EETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGLELGVAETTLMKAICKATGR 202
            ....||:.:.|.|.|...:|:..:|||||.:||||.|::|||:||:|||:.|:|::|||.:|.||
plant   188 SNESGRIVITDILCNMLRTVIATTPEDLVATVYLSANEIAPAHEGVELGIGESTIIKAISEAFGR 252

  Fly   203 NLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIAKLSG----QSKMDLVYN 263
            ...|:|.|....||||:||:.||.:|.|||:|.||.|..||...|:|||.||    :.|.:.:..
plant   253 TEDHVKKQNTELGDLGLVAKGSRSTQTMMFKPEPLTVVKVFDTFRQIAKESGKDSNEKKKNRMKA 317

  Fly   264 MFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLV-KKNHIDDCKASKVPDVYKDEIVDTT 327
            :.||....|..:..|.|..|||:|.:.|::|.||....| .:.|      ||.|...|..:.:..
plant   318 LLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALGQAAVYNEEH------SKPPPNTKSPLEEAA 376

  Fly   328 LLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITC 392
            .::|..:...|.||||:||:|...:..|.:.|....|:|:.||||:|||||.|:..:|..:..||
plant   377 KIVKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPMLAKPTKGVAEILNKFQDIVFTC 441

  Fly   393 EWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERK 457
            |:||||||||||..|.|...|:|||:|.||.||||:....:.|.|..|||:|:|.|:||:|.|:|
plant   442 EYKYDGERAQIHFMEDGTFEIYSRNAERNTGKYPDVALALSRLKKPSVKSFILDCEVVAFDREKK 506

  Fly   458 QILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKF 522
            :|||||:||||.||||::.:|||.||::.||:||:||..|:.:||..||:.|.|.|:|..|.::|
plant   507 KILPFQILSTRARKNVNVNDIKVGVCIFAFDMLYLNGQQLIQENLKIRREKLYESFEEDPGYFQF 571

  Fly   523 ATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLV 587
            |||:.:|||||:|:||:.|:...||||::||||.:||||.||||.|||||||||:.::|||:|||
plant   572 ATAVTSNDIDEIQKFLDASVDVGCEGLIIKTLDSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLV 636

  Fly   588 VIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYR 652
            .|..:.|:|:|||.||.|||||||.:.||:||||||||||:|..|...|..|...|.:..|.|||
plant   637 PIAAFHGRGKRTGVYGAFLLACYDVDKEEFQSICKIGTGFSDAMLDERSSSLRSQVIATPKQYYR 701

  Fly   653 YDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDA 717
            ...||.||.||||.:|||||.|||::||:||||.||||.::||||||||.:|:|:||..|.||.:
plant   702 VGDSLNPDVWFEPTEVWEVKAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSS 766

  Fly   718 NQVAHMYQSQDQVKNNQKSSTQMEMEDE 745
            .|:|.:||:|   |:|..|: :::.:|:
plant   767 EQIADLYQAQ---KHNHPSN-EVKGDDD 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 344/742 (46%)
DNA_ligase_A_N 126..292 CDD:282522 75/170 (44%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 124/218 (57%)
OBF_DNA_ligase_I 581..726 CDD:153438 87/145 (60%)
LIG1NP_172293.2 PLN03113 49..790 CDD:215584 344/742 (46%)
DNA_ligase_A_N 176..347 CDD:282522 75/171 (44%)
Adenylation_DNA_ligase_I_Euk 407..625 CDD:185710 124/218 (57%)
OBF_DNA_ligase_I 630..775 CDD:153438 87/145 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 632 1.000 Inparanoid score I190
OMA 1 1.010
OrthoDB 1 1.010 D274264at2759
OrthoInspector 1 1.000 T125076
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.