DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and ATLIG4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_568851.2 Gene:ATLIG4 AraportID:AT5G57160 Length:1219 Species:Arabidopsis thaliana

Alignment Length:727 Identity:180/728 (25%)
Similarity:301/728 (41%) Gaps:209/728 (29%)


  Fly   127 YLALARTFQVIEETKGR-------LKMIDTL---SNFFCSVMLVSPEDLVPSVYLSINQLAPAYE 181
            :..|...|..|:::|..       .|.:||.   |::|.:|.|:.|         |:::...:| 
plant     7 FSVLVSLFNWIQKSKTSSQKRSKFRKFLDTYCKPSDYFVAVRLIIP---------SLDRERGSY- 61

  Fly   182 GLELGVAETTLMKAI--------------------CKATGRNLAHIKSQTQLTGDLGIVAEQSRV 226
            ||:..|..|.|:.|:                    .|| |.|          .|:..::|.:. :
plant    62 GLKESVLATCLIDALGISRDAPDAVRLLNWRKGGTAKA-GAN----------AGNFSLIAAEV-L 114

  Fly   227 SQRMMFQPAPLNVRDVFRKLREIAKLSGQSKMDLVYNMFV-ACRSSEARFFIRSLIGKLRIGIAE 290
            .:|.......|.::::...|..:|....:::..||.:..: ...:.|.::.||.::..|::|::|
plant   115 QRRQGMASGGLTIKELNDLLDRLASSENRAEKTLVLSTLIQKTNAQEMKWVIRIILKDLKLGMSE 179

  Fly   291 QSLLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKEL 355
            :|:.        ::.|         ||.  :::.:.|       |.           ||...::|
plant   180 KSIF--------QEFH---------PDA--EDLFNVT-------CD-----------LKLVCEKL 207

  Fly   356 QERCPMHP------GMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIF 414
            ::|...|.      |..:||.||.....|:..:::..|..:..|.|:||:|.|||:|.. :|..|
plant   208 RDRHQRHKRQDIEVGKAVRPQLAMRIGDVNAAWKKLHGKDVVAECKFDGDRIQIHKNGT-DIHYF 271

  Fly   415 SRN----SENNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPF---QVLSTRKRKN 472
            |||    ||...| ..|||.::..     |...|:|.|::.||....:...|   |.::...|:.
plant   272 SRNFLDHSEYAHA-MSDLIVQNIL-----VDKCILDGEMLVWDTSLNRFAEFGSNQEIAKAAREG 330

  Fly   473 VDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLL----------LE----------HFQEVE 517
            :|..:   |:|...||:||:..|:::.::|.||.:||          ||          |....|
plant   331 LDSHK---QLCYVAFDVLYVGDTSVIHQSLKERHELLKKVVKPLKGRLEVLVPEGGLNVHRPSGE 392

  Fly   518 GEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGD 582
            ..|    ::..:...:|::|.:|:::...||:::|  |.|:.:|...||..|:|||.:|: ..|.
plant   393 PSW----SIVVHAAADVERFFKETVENRDEGIVLK--DLESKWEPGDRSGKWMKLKPEYI-RAGA 450

  Fly   583 SLDLVVIGGYKGKGRRTGTYGGFLLACYDTEN-----EEYQSICKIGTGFTDEDLQTHSEFLGKH 642
            .||:::||||.|.|||.|....||:|..|...     ..:.|.|::|||.:|::|.|        
plant   451 DLDVLIIGGYYGSGRRGGEVAQFLVALADRAEANVYPRRFMSFCRVGTGLSDDELNT-------- 507

  Fly   643 VTSAAKSYYRYD-------PSL---------EPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDG 691
            |.|..|.|:|.:       ||.         .||.|.:              ||.....:.|...
plant   508 VVSKLKPYFRKNEHPKKAPPSFYQVTNHSKERPDVWID--------------SPEKSIILSITSD 558

  Fly   692 ERGI---------SLRFPRFIRIRDDK---------------NSENATDANQVAHMYQSQDQVKN 732
            .|.|         ||||||..::|.||               ||.|.|...| .....:||..|.
plant   559 IRTIRSEVFVAPYSLRFPRIDKVRYDKPWHECLDVQAFVELVNSSNGTTQKQ-KESESTQDNPKV 622

  Fly   733 NQKSSTQMEMED 744
            | |||.:.|.::
plant   623 N-KSSKRGEKKN 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 180/728 (25%)
DNA_ligase_A_N 126..292 CDD:282522 38/196 (19%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 71/251 (28%)
OBF_DNA_ligase_I 581..726 CDD:153438 53/190 (28%)
ATLIG4NP_568851.2 DNA_ligase_A_N 6..182 CDD:282522 39/197 (20%)
dnl1 61..600 CDD:273147 154/628 (25%)
Adenylation_DNA_ligase_IV 215..446 CDD:185713 70/247 (28%)
OBF_DNA_ligase_IV 449..593 CDD:153437 48/166 (29%)
BRCT 655..726 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.