DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and Lig1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001019439.1 Gene:Lig1 RGDID:621424 Length:913 Species:Rattus norvegicus

Alignment Length:775 Identity:379/776 (49%)
Similarity:518/776 (67%) Gaps:48/776 (6%)


  Fly    10 KKKSDATDSPSP--------PKKVPKIDAKTELPDEPHIKSES-------------ASPETKPKV 53
            |:|.:.|.:|:.        .:|..:::.:..:|.||....||             |..:.||:.
  Rat   146 KRKKEDTQTPTESLTEAEEVKQKEEQVEDQPTVPPEPTESPESVTLTKTENIPMCKAGVKQKPQE 210

  Fly    54 EPMSVDSEEKTSPVKN--------VKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADS 110
            |..|........|:.:        ||.|.|: ::..|.:|..|.|       ..|..||:||..:
  Rat   211 EEQSKPPARGAKPLSSFFTPRKPAVKTEVKQ-EESDTPRKEETKG-------APDPTNYNPSKSN 267

  Fly   111 YHPLKNAYWKDKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQ 175
            |||:::|.||..:..|:||:||||:.|||...||||::||||...||:.:||.||:|.:|||:|:
  Rat   268 YHPIEDACWKHGQKVPFLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPTDLLPVLYLSLNR 332

  Fly   176 LAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVR 240
            |.|..:||||||.:..|:||:.:||||.|..|:::....||:|:|||.||.:||:|..|.||.|.
  Rat   333 LGPPQQGLELGVGDGVLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTVS 397

  Fly   241 DVFRKLREIAKLSGQS----KMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTAL--AI 299
            .||.|..:||:|:|.:    |||::..:|||||.|||||..|||.|:||:|:||||:|.||  |:
  Rat   398 GVFTKFCDIARLTGSASMAKKMDIIKGLFVACRYSEARFIARSLSGRLRLGLAEQSVLAALAQAV 462

  Fly   300 GLVKKNH-----IDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERC 359
            .|.....     :.|....|..:..|..:.:..::||..:|:.|:.|.|||.:|::.::.|.|.|
  Rat   463 SLTPPGQEFPTAVVDAGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLESLPEHC 527

  Fly   360 PMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAK 424
            .:.||:||:||||.||:||.||.:||..:..|||:||||:|||||..|.||:.|||||.|:|:.|
  Rat   528 KLSPGVPLKPMLAHPTRGVREVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNSGK 592

  Fly   425 YPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDL 489
            |||:|:|...:....|.|:|:|:|.||||.|:|||.|||||:|||||.||..||:||||:|.|||
  Rat   593 YPDIISRIPKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDL 657

  Fly   490 LYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTL 554
            :|:||.:|..:.||.||:||.|:|.|.|||:.|||:|||.||:::.:|||:|:|.:|||||||||
  Rat   658 IYLNGESLARQPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTL 722

  Fly   555 DEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQS 619
            |.:|||||||||.||||||||||..|||:|||||||.|.|:|:|.|.|||||||.||.|:||.|:
  Rat   723 DVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESEELQA 787

  Fly   620 ICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRA 684
            |||:||||:||:|:.|.:.:...:....:.|.|.|.::.||||.:|..||||||||||||||:.|
  Rat   788 ICKLGTGFSDEELEEHHQSMQALLLPTPRPYVRIDGAVAPDHWLDPSVVWEVKCADLSLSPIYPA 852

  Fly   685 AIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQMEMED 744
            |.|:||.|:|||||||||||:|:||..|.||.::|||.:|:.|.|::|.|.|....::||
  Rat   853 ARGLVDKEKGISLRFPRFIRVREDKQPEQATTSDQVASLYRKQSQIQNQQSSDLDSDVED 912

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 379/776 (49%)
DNA_ligase_A_N 126..292 CDD:282522 91/170 (54%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 136/218 (62%)
OBF_DNA_ligase_I 581..726 CDD:153438 87/145 (60%)
Lig1NP_001019439.1 PLN03113 159..909 CDD:215584 373/758 (49%)
DNA_ligase_A_N 283..454 CDD:282522 92/171 (54%)
Adenylation_DNA_ligase_I_Euk 526..744 CDD:185710 136/218 (62%)
OBF_DNA_ligase_I 749..894 CDD:153438 87/145 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332578434
eggNOG 1 0.900 E1_COG1793
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 733 1.000 Inparanoid score I564
OMA 1 1.010
OrthoDB 1 1.010 D182401at33208
OrthoFinder 1 1.000 FOG0003190
OrthoInspector 1 1.000 T619204
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 O PTHR45674
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.