DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001096593.1 Gene:lig4 ZFINID:ZDB-GENE-070820-10 Length:909 Species:Danio rerio

Alignment Length:677 Identity:162/678 (24%)
Similarity:293/678 (43%) Gaps:131/678 (19%)


  Fly   126 PYLALARTFQVIEETKGR------LK-MIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAY--E 181
            |::.|....:.|::||.|      || .||:..||..::...:| |...|.|.::..:.|::  |
Zfish    20 PFIHLCTVLEKIQKTKLRPDKSKILKEFIDSWRNFHAALHKDNP-DTADSFYAAMRLIVPSFERE 83

  Fly   182 GLELGVAETTLMKAICKATG--------RNLAHIKSQTQLTGDLGIVAEQSR-VSQRMMFQPAPL 237
            .:..|:.|..|.|...:..|        ..|.:.::.|...|:.|..|..:. |.::.......|
Zfish    84 RMAYGIKENMLAKLYIEVLGLPKNGDEANKLLNYRAPTTSQGEAGDFALMAYFVLKKRCTSQGNL 148

  Fly   238 NVRDVFRKLREIA-----KLSGQSKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTAL 297
            ::::|...|..:|     |...|.|..|:: :.....:.|.::.||.::..:::||:::::|...
Zfish   149 SIKEVNDFLGSVATNNASKQKDQVKKSLLH-LITQSSALEQKWLIRMILKDMKLGISKETVLQVF 212

  Fly   298 AIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMH 362
                    |.|      .|:.|.   |.|.|.........|:..:...:|..:.           
Zfish   213 --------HPD------APEFYN---VTTDLNKVCRQLHDPSVSLSEVSIDLFS----------- 249

  Fly   363 PGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEI-SIFSRNSENNTAKYP 426
               ..:|||| ....:.::.::.|......|.|.||||.|:|:  .|:: ..::|||...|.:: 
Zfish   250 ---AFKPMLA-AVANIRQIEKQMGNRPFYIETKLDGERIQLHK--AGDVYKYYTRNSYEYTQQF- 307

  Fly   427 DLIARSTALLKGDVKSY------------IIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEI- 478
                 ..:.|:|.:..|            |:|.|::|::.:.:..:       :|....||:.: 
Zfish   308 -----GASPLEGSLTPYIHTVFSPHVVNCILDGEMMAYNPKTETFM-------QKGSKFDIKRLV 360

  Fly   479 ---KVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEE 540
               .:|.|..:||:|.||......:.|.:|.:.|...|..::|.....:..:...:.||...|.|
Zfish   361 DDSDLQTCFCVFDVLLINNQKFGKEPLKKRYESLETVFSPIKGRIHLVSKSEGRTMQEVVNSLNE 425

  Fly   541 SIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGF 605
            :|....||:|||  |..:.|:..||...|||:|.:|:..:.|.|||:::|||.|||||:|....|
Zfish   426 AIDNREEGIMVK--DPMSIYKPDKRGEGWLKIKPEYVDGLMDELDLLIVGGYWGKGRRSGMLSHF 488

  Fly   606 LLACYDTEN-----EEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDP-------SLE 658
            |.|..:..:     ..:.::|:||:|:|.::|......|.||    .|.|.:.:|       :.:
Zfish   489 LCAVAEVPSPGEKPTVFHTLCRIGSGYTLKELYDLGVKLAKH----WKVYNKNNPPAAILCGTEK 549

  Fly   659 PDHWFEPVQ--VWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENA---TDAN 718
            |:.:.||..  :.:||.|::..|.:::.         ..:|||||..|||:||.....   .|.|
Zfish   550 PEVYIEPRNSVILQVKAAEIVTSEMYKT---------DCTLRFPRIERIREDKEWHQCMTLDDLN 605

  Fly   719 QV----------AHMYQSQDQVKNNQK 735
            |.          .|:...:||.:..::
Zfish   606 QFRSKASGKLASRHLNIHEDQPEKKKR 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 162/678 (24%)
DNA_ligase_A_N 126..292 CDD:282522 42/189 (22%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 58/235 (25%)
OBF_DNA_ligase_I 581..726 CDD:153438 49/172 (28%)
lig4NP_001096593.1 DNA_ligase_A_N 20..208 CDD:282522 42/190 (22%)
dnl1 86..606 CDD:273147 140/583 (24%)
Adenylation_DNA_ligase_IV 240..461 CDD:185713 60/253 (24%)
OBF_DNA_ligase_IV 464..601 CDD:153437 45/150 (30%)
DNA_ligase_IV 754..786 CDD:288294
BRCT <845..896 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.