DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig3

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001025345.2 Gene:lig3 ZFINID:ZDB-GENE-030131-8453 Length:1011 Species:Danio rerio

Alignment Length:802 Identity:200/803 (25%)
Similarity:332/803 (41%) Gaps:154/803 (19%)


  Fly     5 ITSFFKKKSDATDSPSPPKKVPKIDAKTELPDE------PHIKSESASPETKPKVE---PMSVDS 60
            :...|:|...|..:....:.:.:::...||.||      .|:...:|...:.||.:   .::...
Zfish   139 VKCIFEKLERARATTKKIEDITELEGWEELQDEDKDLINKHVSELAAKVNSTPKKKVQAKLNTSG 203

  Fly    61 EEKTSPVKNVKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWKDKKVT 125
            :..:.|.......|::....|              |||....:..|......|.:.:....:...
Zfish   204 QLSSPPADPTVNAPRKFSGFT--------------ATKAGSSSSSPGPSPAKPAQGSVLSAQMCD 254

  Fly   126 PYLA--LARTFQ----VIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGLE 184
            |...  |.|.|:    ::.|..|.....:.:.:|.....  ..:.....:||::..|.|      
Zfish   255 PTHKDNLLREFRKLCALVAEKSGYNAKTEIVRDFLTKGS--GGDKFRGDLYLTVKLLLP------ 311

  Fly   185 LGVAETTLM---KAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQ--RMMFQPAP-------- 236
             ||.:....   |.|.|...|.|.  .:|..:..||    ||..||:  ||.|:.:.        
Zfish   312 -GVVKNVYNLNDKQIVKLFSRILN--CNQDDMVQDL----EQGDVSETVRMFFEESKSFPPSAKS 369

  Fly   237 -LNVRDVFRKLREIAKLSGQSKMDL-VYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAI 299
             |.:::|...|..:::|:.:..... :.::...|..::.:.:||.:...|:|....:.:|.|   
Zfish   370 LLTIQEVDASLSRLSQLTKEDDQQAELQSIAKKCTGNDLKCYIRLVKHDLKINSGAKHILDA--- 431

  Fly   300 GLVKKNHIDDCKASKVPDVYKDEIVDTTLLLK--TAYCQCPNYDIIIPAILKYDIKELQERCPMH 362
              |..|..|..|||:    ...:::|..|..:  .:....|...:.|.|.|.             
Zfish   432 --VDPNAYDAFKASR----NLGDVIDRVLRNQQDASNGTGPRKILSIEASLM------------- 477

  Fly   363 PGMPLRPMLAQPTKGVHEVFERF-GGMQITCEWKYDGERAQIHRNEKGEISIFSRNSE----NNT 422
              .|::||||:..|.:....::. .||.  .|.||||||.|:|:| ....|.|||:.:    :..
Zfish   478 --TPVQPMLAEACKSIEYAMKKCPNGMY--SEIKYDGERVQVHKN-GNHFSYFSRSLKPVLPHKV 537

  Fly   423 AKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIF 487
            |.:.|.|.::.|    ...|.|:|:|::..|.:..:.|||..|...|:....    ..||.:::|
Zfish   538 AHFKDFIPQAFA----GGHSMILDAEVLLIDTKTSKPLPFGTLGVHKKAAFQ----DAQVGLFVF 594

  Fly   488 DLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVK 552
            |.:|.||.:|:.|.|.||||.|.::..||.....|:.........::.:.:...|:...|||::|
Zfish   595 DCIYFNGVSLMDKPLCERRKFLHDNMVEVPNRILFSEMKHVTRAPDLAEMITRVIREGLEGLVLK 659

  Fly   553 TLDEEATYEIAKRSRNWLKLKKDYLSN--VGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENE 615
              |.:..||..|  |:|||:|||||:.  :.|:.||||:|.:.|||...|....||:.|||.|:.
Zfish   660 --DIKGLYEPGK--RHWLKVKKDYLNEGAMADTADLVVLGAFYGKGSNGGIMSSFLMGCYDPESR 720

  Fly   616 EYQSICKIGTGFTD-------EDLQTHSEFLGKHVT------SAAKSYYR----YDPSLEPDHWF 663
            ::.::.|...||.|       :||....  :||..:      ...|:||.    .||...|    
Zfish   721 KWCTVTKCSGGFDDAMLDRLQKDLDVIK--IGKDPSKIPGWLKIVKNYYPDFIIRDPQKAP---- 779

  Fly   664 EPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQ--- 725
                |||:..|:.|.|.:|.|        .|||:||||..|:||||:.:.||:..|:..:|:   
Zfish   780 ----VWEITGAEFSKSEMHTA--------DGISIRFPRCTRMRDDKDWKTATNLQQLKELYRISK 832

  Fly   726 ---------SQDQVKNNQKSST 738
                     ...:...|.|||:
Zfish   833 ENCDFEVTAGPSKANQNDKSSS 854

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 200/803 (25%)
DNA_ligase_A_N 126..292 CDD:282522 37/187 (20%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 70/223 (31%)
OBF_DNA_ligase_I 581..726 CDD:153438 54/174 (31%)
lig3NP_001025345.2 zf-PARP 95..178 CDD:279039 7/39 (18%)
DNA_ligase_A_N 263..428 CDD:282522 35/180 (19%)
dnl1 317..829 CDD:273147 164/575 (29%)
Adenylation_DNA_ligase_III 467..679 CDD:185712 73/242 (30%)
OBF_DNA_ligase_III 685..823 CDD:153436 52/156 (33%)
LIG3_BRCT 935..1006 CDD:293364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.