DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001119860.1 Gene:lig1 ZFINID:ZDB-GENE-110404-2 Length:1058 Species:Danio rerio

Alignment Length:773 Identity:415/774 (54%)
Similarity:532/774 (69%) Gaps:49/774 (6%)


  Fly    10 KKKSD--ATDSPSPPKKVPKIDAKTELPDEPHIKSESASPETKPKVE-----------PMSVDSE 61
            |.|||  ..:.....:||...:.|.::||:.  ..||:|||...|.|           |:|....
Zfish   299 KDKSDKKQEEKDKTEEKVNGENEKEKIPDKK--GKESSSPEKVVKKEKDTDGGSAKKKPISSFFA 361

  Fly    62 EKTSPVKNVKKE----PKEVDDKTTD-----KKVTTIGLNSTAATKEDVENYDPSADSYHPLKNA 117
            .:.:.||..|:|    .|:.|.:|:|     :|.:..|::|...::     ||||...|||:.:|
Zfish   362 PRKAAVKLEKEERNEGEKKKDGETSDVVEQKEKKSEKGVDSAVQSQ-----YDPSRAHYHPIDHA 421

  Fly   118 YWKDKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEG 182
            .||..:..||||:||||:.|||..||||.|:|||||..||:|:||:||:..|||.:|||.|||:|
Zfish   422 CWKKGQKVPYLAVARTFEKIEEDSGRLKNIETLSNFLRSVILLSPDDLLCCVYLCLNQLGPAYQG 486

  Fly   183 LELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLR 247
            ||||:.||.||||:.:||||.|..||::.|..||||:|||.||.:|||||.||.|....||.||:
Zfish   487 LELGIGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNKLK 551

  Fly   248 EIAKLSGQS----KMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTAL--AIGLVKKNH 306
            |||.:||.|    |:|::..:|||||.||||:.:|||.||||||:||||:|.||  |:.|.....
Zfish   552 EIAHMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLAALSQAVCLTPPGQ 616

  Fly   307 ------IDDCKASKVPD--VYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHP 363
                  :|..|.....:  |:.:|   ..|:||..||:.||||.|||.:||..|.||...|.:.|
Zfish   617 EFPPAVLDAGKGMSTENRRVFLEE---KALILKQTYCEMPNYDAIIPVLLKEGIDELPNHCKLTP 678

  Fly   364 GMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDL 428
            |:|||||||.|||||.||.:||.....|||:||||||||||..|.||:.|||||.|:||:||||:
Zfish   679 GVPLRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTSKYPDI 743

  Fly   429 IARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYIN 493
            |:|...:.|..|:|.::|||.||||.|:|||.|||||:|||||:||..|||||||||.|||||:|
Zfish   744 ISRIPQVKKESVRSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLN 808

  Fly   494 GTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEA 558
            |.:||.:.||:||.||.|.|.|.|||:.||.:||.::.:.:.:|||:|::.:|||||||||::.|
Zfish   809 GESLVREPLSKRRALLRESFVEKEGEFVFARSLDADNTETIAEFLEQSVRDSCEGLMVKTLEKHA 873

  Fly   559 TYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKI 623
            ||||||||.||||||||||..|||::||.|||.|.|||:|.|.||||||||||.||||:||:|||
Zfish   874 TYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLGKGKRAGGYGGFLLACYDEENEEFQSVCKI 938

  Fly   624 GTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGI 688
            ||||.||||:.|..||.:|:....:.|||.|.|.|||.|.|.|||||||||||||||:::||:|:
Zfish   939 GTGFKDEDLEQHYNFLKEHILPKPRPYYRVDQSAEPDVWLEAVQVWEVKCADLSLSPVYKAAMGL 1003

  Fly   689 VDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQMEMEDEF 746
            ||.|:|||||||||:||||||..|:||..:|:|.:|:.|.|::|   ...:.::||.:
Zfish  1004 VDPEKGISLRFPRFLRIRDDKKPEDATTGSQIADLYKKQQQIQN---QGDKPDLEDYY 1058

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 415/771 (54%)
DNA_ligase_A_N 126..292 CDD:282522 106/170 (62%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 139/218 (64%)
OBF_DNA_ligase_I 581..726 CDD:153438 96/145 (66%)
lig1NP_001119860.1 PLN03113 301..1053 CDD:215584 412/765 (54%)
DNA_ligase_A_N 430..601 CDD:282522 107/171 (63%)
Adenylation_DNA_ligase_I_Euk 673..891 CDD:185710 139/218 (64%)
OBF_DNA_ligase_I 896..1041 CDD:153438 96/145 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332578956
eggNOG 1 0.900 E1_COG1793
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 772 1.000 Inparanoid score I509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D182401at33208
OrthoFinder 1 1.000 FOG0003190
OrthoInspector 1 1.000 T1054587
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2092
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.