DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001016981.1 Gene:lig4 XenbaseID:XB-GENE-964443 Length:911 Species:Xenopus tropicalis

Alignment Length:682 Identity:159/683 (23%)
Similarity:288/683 (42%) Gaps:138/683 (20%)


  Fly   126 PYLALARTFQVIEETKGRL-------KMIDTLSNFFCSVMLVSP---EDLVPSVYLSINQLAPAY 180
            |:..|..|.:.:::.|.|.       :.:|:...|..::....|   :...|::.|.:.||  ..
 Frog    20 PFADLCCTLEKVQKCKNRTEKSHIFKQFVDSWRKFHEALHKSQPKTTDSFYPAMRLVVPQL--ER 82

  Fly   181 EGLELGVAETTLMKAICKATGR--------NLAHIKSQTQLTGDLGIVAE------QSRVSQRMM 231
            |.:..|:.||.|.|...|..|.        .|.:.:|.|....|.|..|.      :||..:.  
 Frog    83 ERMAYGIKETMLAKLYIKVLGLPKEGKDAIKLLNYRSPTSSHSDAGDFAAIAYFVLKSRCRKE-- 145

  Fly   232 FQPAPLNVRDVFRKLREIAKLSGQSKMDLV----YNMFVACRSSEARFFIRSLIGKLRIGIAEQS 292
               ..|::::|...|..||..:...|.:|:    .::.....:.|.::.||.:|..:::|.::|:
 Frog   146 ---GSLSIQEVNYHLDSIANNNAAKKKELIEKSLLHLIANTTALEQKWLIRMIIKDMKLGFSQQT 207

  Fly   293 LLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNY---DIIIPAILKYDIKE 354
            :.:..        |         ||..:...|.|.|.........||.   |:.|.....:    
 Frog   208 VFSIF--------H---------PDAAELHNVTTDLEKVCIQLHDPNVCLSDVSISMFSAF---- 251

  Fly   355 LQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEI-SIFSRNS 418
                         :|||| ....:..:.::........|.|.||||.|:|::  |:: ..||||.
 Frog   252 -------------KPMLA-AIANIQNIEKQMNHQSFYIETKLDGERMQMHKD--GDVYKYFSRNG 300

  Fly   419 ENNTAKYPDLIARSTALLKGDVKSY------------IIDSEIVAWDVERKQILPFQVLSTRKRK 471
            .:.|.::      ..:.|:|.:..|            |:|.|::|::...:..:       :|..
 Frog   301 FDYTQQF------GASPLEGSLTPYIHNAFSLNIQNCILDGEMMAYNPNTQTFM-------QKGN 352

  Fly   472 NVDI----EEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDID 532
            ..||    ::.::|.|..:||:|.:|...|..:.|.:|..:|.|.|..:.|.:......:.:...
 Frog   353 KFDIKRMVDDSELQTCYCVFDVLLLNDQKLAHETLRKRYDILQEIFIPIPGRFHIVDKTEASTKK 417

  Fly   533 EVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGR 597
            .|...|.|:|....||:|||  |..:.|:..||...|||:|.:|::.:.|.|||::||||.|||.
 Frog   418 NVVDALNEAIDKREEGIMVK--DPMSIYKPDKRGEGWLKIKPEYVNGLMDELDLIIIGGYWGKGS 480

  Fly   598 RTGTYGGFLLACYDTEN-----EEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSL 657
            |.|....||....:...     ..:.|||::|:|:|.::|..    ||..:....|:|.:.||..
 Frog   481 RGGMMSHFLCGVAEASGPGEKPSVFHSICRVGSGYTMKELFD----LGLKLAPHWKTYRKRDPPS 541

  Fly   658 -------EPDHWFEPVQ--VWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSEN 713
                   :|:.:.:|..  :.::|.|::..|.:::.         |.:|||||..:||:||   .
 Frog   542 NILCGIEKPEAYIQPCNSVIVQIKAAEIVTSDMYKT---------GCTLRFPRIEKIREDK---E 594

  Fly   714 ATDANQVAHMYQSQDQVKNNQKSSTQMEMEDE 745
            ..|...:..:.|.:|:. :.:.:|..:.::||
 Frog   595 WYDCMTLDDLEQFRDKA-SGKLASKHLHIDDE 625

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 158/681 (23%)
DNA_ligase_A_N 126..292 CDD:282522 41/194 (21%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 58/235 (25%)
OBF_DNA_ligase_I 581..726 CDD:153438 45/159 (28%)
lig4NP_001016981.1 DNA_ligase_A_N 20..208 CDD:282522 41/195 (21%)
dnl1 86..606 CDD:273147 141/593 (24%)
Adenylation_DNA_ligase_IV 240..461 CDD:185713 61/256 (24%)
OBF_DNA_ligase_IV 464..601 CDD:153437 44/153 (29%)
BRCT 659..733 CDD:214602
DNA_ligase_IV 753..786 CDD:288294
BRCT 809..898 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.