DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig3

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_012827218.1 Gene:lig3 XenbaseID:XB-GENE-5788004 Length:982 Species:Xenopus tropicalis

Alignment Length:808 Identity:207/809 (26%)
Similarity:334/809 (41%) Gaps:219/809 (27%)


  Fly    12 KSDAT---DSPSPPKKVPKIDAKTELPDEPHIKSESASP-------ETKPKVEPMSVDSEEKTSP 66
            |:.||   .:||..|:.|.:...|.      ..:.:|||       ..||. :..|..|....|.
 Frog   155 KTAATPRKKTPSKEKQSPAVQGTTS------TTAPAASPSLKFSGFSAKPS-QSSSPPSSSTGSS 212

  Fly    67 VKNVKKEPKEVDDKTTD-KKVTTI-----GLNSTAATKEDVENYDPSADSYHPLKNAYWKDKKVT 125
            :...|.:||..|....: :|:..:     ..||......|......|.|.:|.            
 Frog   213 LSTAKCDPKHKDCLLREFRKLCAMVAEQPSYNSKTQIIRDFLTKGTSGDGFHG------------ 265

  Fly   126 PYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGLELGVAET 190
                                  ||    :.:|.|:.| .::.||| ::|.               
 Frog   266 ----------------------DT----YLTVKLLLP-GVIKSVY-NLND--------------- 287

  Fly   191 TLMKAICKATGR--NLAHIKSQTQLTGDL--GIVAEQSRV--SQRMMFQPAPLN------VRDVF 243
               |.|.|...|  |.    :|.::..||  |.|:|..|:  .:...|.||..:      |.|:.
 Frog   288 ---KQIVKHFSRIFNC----NQEEMVRDLEQGDVSETVRIFFEESKCFAPASKSLLTIHEVDDLL 345

  Fly   244 RKLREIAKLSGQSKM--DLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLVKKNH 306
            .||.::.|...|..:  |:.:.    |.|::.:..||.:...|::....:.:|.||     ..|.
 Frog   346 TKLSKMTKEEDQQNVLEDIAHR----CTSNDLKCIIRLIKHDLKMNSGAKHVLDAL-----DPNA 401

  Fly   307 IDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGM------ 365
            .|..|||:                        |...::..:|:   .|.|.     |||      
 Frog   402 YDAFKASR------------------------NLGDVVERVLR---NEQQA-----PGMKRTLSV 434

  Fly   366 ------PLRPMLAQPTKGVHEVFERF-GGMQITCEWKYDGERAQIHRNEKGE-ISIFSRNSE--- 419
                  |::||||:..|.:....::. .||.  .|.||||||.|:|:|  |: .|.|||:.:   
 Frog   435 QASLMTPVQPMLAEACKSIEYAMKKCPNGMY--AEIKYDGERVQVHKN--GDHFSYFSRSLKPVL 495

  Fly   420 -NNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKR---KNVDIEEIKV 480
             :..|.:.|.|.:  |...|:  |.|:|:|::..|....:.|||..|...|:   |:.:      
 Frog   496 PHKVAHFKDFIPK--AFPGGN--SMILDAEVLLIDTNTGKPLPFGTLGVHKKAAFKDAN------ 550

  Fly   481 QVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGN 545
             ||:::||.:|.||.:|:.:.||||||.:.::..|:.....|:.........::...:...|:..
 Frog   551 -VCLFVFDCIYFNGVSLMDRPLSERRKFMRDNMVEIPNHILFSEMKHVTKASDLADMITRVIREG 614

  Fly   546 CEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSN--VGDSLDLVVIGGYKGKGRRTGTYGGFLLA 608
            .|||::|  |.::.||..|  |:|||:|||||:.  :.|:.||.|:|.|.|||...|....||:.
 Frog   615 LEGLVLK--DLKSNYEPGK--RHWLKVKKDYLNEGAMADTADLAVLGAYYGKGANGGIMSIFLMG 675

  Fly   609 CYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVT--------SAAKSYYRYDPSLEPD---HW 662
            |||.|::::.::.|..:|:.|..||.    |.|.:.        |...|:.:.:.:..||   |.
 Frog   676 CYDPESQKWCTVTKCSSGYDDATLQR----LQKELNMVKISKDPSKIPSWLKINKNYFPDFIIHD 736

  Fly   663 FEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQ-- 725
            .:...:||:..|:.|.:..|.||        |:|:||||..|.||||:.:.||...|:..:|:  
 Frog   737 PKKAPIWEITGAEYSKAEAHTAA--------GLSIRFPRCTRFRDDKDWKTATTLQQLKELYRLS 793

  Fly   726 ------------SQDQVKNNQKSSTQME 741
                        |||:..:::.||.:.|
 Frog   794 KEKSDFNITATSSQDEDGSSESSSRENE 821

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 207/809 (26%)
DNA_ligase_A_N 126..292 CDD:282522 36/180 (20%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 74/239 (31%)
OBF_DNA_ligase_I 581..726 CDD:153438 50/170 (29%)
lig3XP_012827218.1 zf-PARP 64..145 CDD:279039
DNA_ligase_A_N 228..393 CDD:282522 43/231 (19%)
dnl1 282..791 CDD:273147 168/604 (28%)
Adenylation_DNA_ligase_III 429..641 CDD:185712 71/231 (31%)
OBF_DNA_ligase_III 647..785 CDD:153436 48/150 (32%)
LIG3_BRCT 905..977 CDD:293364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.