DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and DNAlig3

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_650187.2 Gene:DNAlig3 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster

Alignment Length:689 Identity:170/690 (25%)
Similarity:290/690 (42%) Gaps:139/690 (20%)


  Fly   115 KNAYWKDKKVTPYLALARTF-QVIEETKGR---LKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQ 175
            |..:.:|.|:.       || ::.:|..|.   ||..:.|..||....  |.:.......|.:..
  Fly    24 KGLHNEDNKLD-------TFRRICDEIAGESSYLKKAERLQRFFEKGS--SGKGFKGDTVLWVQF 79

  Fly   176 LAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDL---GIVAEQSR----VSQRMMFQ 233
            |.||.......:....|:|...:....:      |.|:..||   |.|:|..|    .|:::..|
  Fly    80 LIPAANQRVYNLQNKALIKLFSRIFNAD------QQQMHLDLEQDGDVSETLRKHFAASKKLKPQ 138

  Fly   234 -PAPLNVRDVFRKLREIAKLSGQSKM-DLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTA 296
             .:.|.:::|...|..:.:.:.:.:. ||:..:.......:.|.|||.:...|||....:.:|.|
  Fly   139 KQSKLYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDLRTFIRLVKHDLRINARARHILDA 203

  Fly   297 LAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDI---IIPAILKYDIKELQ-- 356
            ..                 ||.|                  |.|..   ::..:.::..||.:  
  Fly   204 FG-----------------PDAY------------------PAYQSSRDLVAIVEQFATKENKNY 233

  Fly   357 -----------ERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGE 410
                       ....:....|:.||||.|.|.|.:.|:: ....:..|.||||||.|||: :..:
  Fly   234 ASSPVKKTKKTSSSAIQVMTPISPMLASPCKSVEDAFKK-SPTGLYSEIKYDGERVQIHK-QGND 296

  Fly   411 ISIFSRNSENNTAKYPDLIARSTALLKGDVKSY------IIDSEIVAWDVERKQILPFQVLSTRK 469
            ...||||.:      |.:..:..||.|...:::      |:||||:..|.:...:|||..|...|
  Fly   297 FKFFSRNLK------PVVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHK 355

  Fly   470 RKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEV 534
            ::..    ....||:::||.:..:|..|......:||::|.::.|.::...:.:.:.......|:
  Fly   356 KQTF----ANAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTREL 416

  Fly   535 QQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYL--SNVGDSLDLVVIGGYKGKGR 597
            .......:..|.||:::|:  ..:||:..|  |||||:|||||  ..:.|:.||||:|.:.|.|:
  Fly   417 AAMTARVLHANLEGVVLKS--PTSTYQPGK--RNWLKVKKDYLFDGKMADTADLVVLGAWYGSGK 477

  Fly   598 RTGTYGGFLLACYDTENEEYQSICKIGTGFTD-EDLQTHSEFL---GKHVTSAAKSYYRYDPSLE 658
            :.||...||:.|||.....::::.|:.:|..| .:.:.|...:   .:...:|..|:.....||.
  Fly   478 KGGTLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKSLV 542

  Fly   659 PDHWF-EPVQ--VWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQV 720
            ||... :|::  |||:..|:.:.|..|.|:        |||:||||..|.|.||   :|.:||.:
  Fly   543 PDVLAKDPMKMPVWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDK---SAKEANDL 596

  Fly   721 AHMYQ------------------SQDQVKNNQKSSTQME 741
            ||:..                  |:|:...|.|::.:.|
  Fly   597 AHLEDLFEASKSNVNVDLLLANCSKDETAMNNKTTPEKE 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 170/690 (25%)
DNA_ligase_A_N 126..292 CDD:282522 38/179 (21%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 64/224 (29%)
OBF_DNA_ligase_I 581..726 CDD:153438 49/170 (29%)
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522 37/172 (22%)
dnl1 88..604 CDD:273147 148/584 (25%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 64/228 (28%)
OBF_DNA_ligase_III 460..598 CDD:153436 48/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105318199
eggNOG 1 0.900 E1_COG1793
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45674
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.